KEGG   Sulfolobus islandicus HVE10/4: SiH_2670Help
Entry
SiH_2670          CDS       T01952                                 

Definition
Protein-L-isoaspartate (D-aspartate)O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sih  Sulfolobus islandicus HVE10/4
Brite
Enzymes [BR:sih01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SiH_2670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2572247..2572957)
Genome map
AA seq 236 aa AA seqDB search
MSAKEDLLRSIKNSKLANAFIKVNREDFLPQLLKKYAYDPNYIDKPFYVTPNITTTALSL
GIYILDILNLEENQKVLEIGTGIGYYTALIAEVVGENNVVSIEIDDTMFEYAKNVLLIRY
PLIKLIKMDGSLGYEREAPYDRIVIWAAAPTIPCKLYEQLKENGIMVAPIGSEKAQGLYR
ITRIGYEPKIERIGDVIFMKMRGLFGFYEDDDPNERRIKKIEEKVNRLLSKFMNQS
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaaaagaagacttattaagatctataaaaaattcaaagttggctaatgcattt
atcaaggttaatagagaagactttttgccgcaactattgaagaaatacgcatatgaccca
aattatatagataaacccttttacgtgacacctaacattacgacaacggcgctaagttta
ggcatatatattcttgatattcttaatttagaagaaaatcagaaggttttagagataggt
actggtataggttattacacagcactgatagctgaagtagttggtgagaataatgttgta
tctatcgaaatcgatgatacgatgtttgagtacgctaaaaatgttcttctgatcagatac
cccctaattaaattaattaagatggatggaagtttaggatatgagagagaggctccttat
gaccgaatcgtaatatgggctgctgcgccgactataccttgtaagttatacgagcaactt
aaggaaaacgggatcatggtagcaccaataggtagtgaaaaagcccaaggtctttatagg
attactagaattggctacgagcctaagatagaaagaattggggatgtaatatttatgaaa
atgagaggcttatttggattttacgaggatgatgatccaaatgagaggagaataaagaaa
atagaagaaaaggtaaataggttgctgtccaaattcatgaatcaaagctag

DBGET integrated database retrieval system