KEGG   Sulfolobus islandicus HVE10/4: SiH_2678Help
Entry
SiH_2678          CDS       T01952                                 

Definition
Triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SiH_2678
   01230 Biosynthesis of amino acids
    SiH_2678
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiH_2678
   00051 Fructose and mannose metabolism
    SiH_2678
   00562 Inositol phosphate metabolism
    SiH_2678
Enzymes [BR:sih01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SiH_2678
Exosome [BR:sih04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SiH_2678
  Exosomal proteins of bladder cancer cells
   SiH_2678
  Exosomal proteins of melanoma cells
   SiH_2678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2578650..2579333)
Genome map
AA seq 227 aa AA seqDB search
MKPPIIVINFKAYENSFGNKAIDLGKKIEKISKEHSVEIILSVPATMIYRMVQEVDLPIY
AEHVDPVPLGAYTGAVLPEMIKDADAKGTLINHSERRLRADEIDDVLKRTRKLGLSSILC
VDRYELVYPFSLLRPDAILIEPPELIGTGISVSKAKPEVITKAVNEIRKSEGIYLIAGAG
ITTGEDVYKALKLGAHGIGVASAVMKAKEPEKVVEDFITSALKAISS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccccctattattgtaataaactttaaggcctacgaaaactcctttggtaataag
gcaattgacttaggtaaaaagatagaaaaaataagtaaggagcattcagttgaaataata
ttgtcagtaccagctactatgatctacagaatggtccaagaggtagatttaccaatttat
gctgaacatgtagatccagttcctctaggcgcttatacgggagccgtattaccagaaatg
ataaaagatgcagatgctaaagggacattgataaatcacagtgagagacgtctaagggct
gatgaaatagatgatgtattaaaaagaactaggaaattaggtttgagtagtatactatgc
gttgacagatatgagttagtctatccctttagtttactaaggcctgatgcaattttgata
gagcctccagaattgataggaaccggtatctcagtatctaaagccaaacctgaggtaata
acaaaagccgtgaatgagataagaaagtctgaggggatctatttaatagcgggtgctgga
attacaaccggtgaggacgtttataaagcgttaaagctaggagctcatggaataggtgta
gcaagtgcagtcatgaaggctaaagagcctgagaaagttgttgaagattttatcacaagt
gcattgaaggctatctcttcttag

DBGET integrated database retrieval system