KEGG   Sulfolobus islandicus L.D.8.5: LD85_0243Help
Entry
LD85_0243         CDS       T01158                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LD85_0243
Enzymes [BR:sii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LD85_0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(205340..206191)
Genome map
AA seq 283 aa AA seqDB search
MIHLAVGRFNIDIIVKLDSIPPIDSSHMTDVLEIMPGGAATNYAVAVTKLGHSAKLLAKV
GKSEVVRSLMEKVVELGVGLEYVEELNEKPSATLIFLRSDGTLSMVRRLGASILLTREDV
KRRFGLFDVIHFASVSPNVVVRDPYAKLVSYDPGPQAKNIESIDVDILYINEKEYEMIEG
KNIKARFIVIKMGKKGAKIITETEECSVEPVQVEKVVDTTGAGDTFDAAFNVTYSEEKDI
IKSLQVASVASGLKVTKIGGISSPTLEEVREYLRKKKPNVICK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgatacacctagcagtggggagatttaacattgatattatagtaaaattggattctatt
ccacctatagattccagtcatatgacggatgttcttgaaatcatgcccggaggagctgca
acaaactatgcagtggcagtgactaaactgggtcactctgctaaactattagcaaaggtt
gggaaaagcgaagtagttagaagtctaatggaaaaagtagtagaattaggggtaggatta
gaatacgtagaggaattaaacgagaaacctagtgcaacactaatcttcttgagaagtgat
ggaacactatctatggtaagaagacttggcgcatcaatattgctaacaagagaagatgta
aaaaggcgttttggactgtttgacgttattcacttcgcctcagtatcaccaaacgttgtt
gtgagagatccttatgcaaaattagtaagctatgatcctggcccacaagctaaaaatata
gagtcgattgacgtagacatcttatatattaatgaaaaagagtatgaaatgatagaaggt
aagaacataaaggccagatttatcgtcattaagatgggcaagaaaggggcaaagataatt
actgagactgaagagtgttcagttgaaccagtacaagtagaaaaggtagttgatactacc
ggagctggagatacttttgatgcagcatttaatgtaacatattctgaggaaaaggatatt
ataaagagtctacaggttgccagcgttgcatctggtcttaaggttacgaagataggagga
atttcttcaccaacattagaagaggtaagagagtatttaaggaagaagaaaccaaatgtt
atatgtaaatga

DBGET integrated database retrieval system