KEGG   Sulfolobus islandicus L.D.8.5: LD85_0281Help
Entry
LD85_0281         CDS       T01158                                 

Definition
(GenBank) Succinate--CoA ligase (ADP-forming)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LD85_0281
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LD85_0281
   00640 Propanoate metabolism
    LD85_0281
   00660 C5-Branched dibasic acid metabolism
    LD85_0281
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LD85_0281
Enzymes [BR:sii01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LD85_0281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(239960..240973)
Genome map
AA seq 337 aa AA seqDB search
MKLYEYEGKSLFKRVGIPVPNGVVTSEPIRWQGKAVVKSQLLEGARGKRGLVRVTEDIYN
TILELKKLGVEKFLVEEFVPHEKEIYASVLLDRETAEPMLVLSREGGIDVEQAKDVKKMI
IPLERGVRSYDIVEAEKYLGVKGLGQIIQGLYKLFVDYDAELVEINPLALTNDGRILALD
SKVILEDNALYRHEDLLKELGRQEVRDSYVELEGDIGIIGNGAGLTMASMDLVKLNGGNP
ANFLDVGGGANREHVKESVLKVGSNPRVKKIVINIYGGITRCDEVALGIIDALKEVKKPI
FVRLLGTNEELGKKILRENGVNVYDDVLKMIGDAVRS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatatgaatatgagggaaagagtctttttaagcgtgtagggataccagtgcct
aatggtgttgtaacttctgaaccaataagatggcaaggaaaagctgtagtgaaatctcaa
ctattggaaggcgctagaggtaaaagaggattagtaagagtaactgaagacatttataat
actattttagaactgaaaaaactaggagtcgagaaattcttagtagaggaatttgttcct
cacgagaaggagatttacgcttcagtattgttagatagggaaactgcggaaccaatgtta
gttttatcaagagaaggaggcattgatgttgaacaagctaaggacgttaagaagatgata
ataccactagagaggggagttaggagttatgatattgttgaggctgagaagtatctagga
gttaagggattaggacaaataatacaaggtttgtataaattatttgtagattacgacgct
gaactagttgagataaacccattagcattgactaatgatggtagaatattagctttagac
tctaaagtgattttagaggataacgcgttatatagacatgaggatttgttaaaggagtta
gggaggcaagaagttcgtgatagttatgtggaactagagggagatataggaataataggc
aatggtgcaggattaaccatggcttcaatggatctagttaaattaaatggcggaaatcca
gcaaatttcttggatgttggtggaggagctaatagggaacatgttaaagaaagtgttctc
aaagtgggtagcaatcctagagtcaaaaagattgttataaatatttacggtggaattact
agatgtgatgaggtagcgttaggtataattgatgcgctaaaggaggtgaagaagccaata
tttgttagattattaggaactaacgaggaattagggaagaaaatattaagagagaacggt
gtaaacgtatatgatgatgtattaaaaatgataggtgatgcagtacgctcataa

DBGET integrated database retrieval system