KEGG   Sulfolobus islandicus L.D.8.5: LD85_0352Help
Entry
LD85_0352         CDS       T01158                                 

Definition
(GenBank) hypothetical protein
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
sii00010  Glycolysis / Gluconeogenesis
sii00020  Citrate cycle (TCA cycle)
sii00620  Pyruvate metabolism
sii00640  Propanoate metabolism
sii00650  Butanoate metabolism
sii00680  Methane metabolism
sii00720  Carbon fixation pathways in prokaryotes
sii01100  Metabolic pathways
sii01120  Microbial metabolism in diverse environments
sii01130  Biosynthesis of antibiotics
sii01200  Carbon metabolism
Module
sii_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LD85_0352
   00020 Citrate cycle (TCA cycle)
    LD85_0352
   00620 Pyruvate metabolism
    LD85_0352
   00640 Propanoate metabolism
    LD85_0352
   00650 Butanoate metabolism
    LD85_0352
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LD85_0352
   00680 Methane metabolism
    LD85_0352
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LD85_0352
Enzymes [BR:sii01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     LD85_0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 Fer4_7 Fer4_16 Fer4_2 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_13 Fer4_4 Fer4_22 Fer4_6
Motif
Other DBs
NCBI-ProteinID: ADB86143
UniProt: D2PFH0
Position
complement(299857..300948)
Genome map
AA seq 363 aa AA seqDB search
MGVKDEVKYVEIVYRGIFQKRLAKYIAEGIVYTAREMGRPALSFGRYGDSPERNGVPAKY
YVGIGNGVNEEDLIGYSTRVEPDLVDTIIVLDDTLLKGVESWAWQGVQPINLKLKSNGTM
LVTSTKRINELLKMIPKKDFNWTLGVINTEPSFSGLWAFKDDLTMEKVWGGLAKLRPDII
DLDHLIKYVSKKQDANKRISAVKEAYSSVDYRTVMKGEGIDFVYNPPRLLTWHEMLEGTV
IPAVPRGKRNELFKRGTTKFERPTVDFDTCIKCKLCWIYCPDECFDETPDGYYDIAYDYC
VGCGICADVCPVKDCIVMVDESMFTDYRRPYEMWKENKAKYKEWLKNVRQARKERVYVPG
LGR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggagtaaaagatgaagtgaagtatgtagagatagtatataggggtatattccagaaa
agattggcaaaatatattgcagaaggaatcgtgtatactgcaagggaaatggggagacca
gccctatctttcggaagatatggagattctccagaaaggaacggagtaccggcgaaatac
tatgttggaataggaaatggagtgaatgaggaagaccttatagggtactcaacaagagta
gagcctgatctagtagataccattattgtactagacgataccctattaaagggtgtagaa
tcgtgggcatggcaaggggtacaaccaatcaaccttaaactaaagagtaacgggacaatg
ttagtaacctctaccaagagaattaacgaattgttgaaaatgatacctaaaaaggacttc
aattggactctaggagtaataaatactgaaccatcattttcgggactatgggcatttaag
gatgatttaacaatggagaaagtctggggaggattagcaaagttaagaccagatataatt
gatttagatcatttaattaaatatgtaagtaaaaagcaagatgctaacaagagaatatct
gcggtcaaggaagcatattcgtcagtagattacagaactgtaatgaaaggtgagggaata
gatttcgtatataatccgcctagactactaacatggcatgagatgttggaaggtacagta
attcccgcagttcctagaggaaagagaaacgaactctttaagagagggactacgaaattt
gagagacctacagtagatttcgacacttgtatcaaatgtaagttatgttggatatactgt
ccggatgaatgttttgatgagacgccagatggatattacgatatagcatatgattactgt
gtaggctgtggcatatgcgctgatgtatgtcccgttaaggattgcatagtaatggtagat
gaatcgatgttcacagattacagaagaccatatgagatgtggaaggagaacaaggcaaag
tataaggaatggttaaagaatgtaaggcaagctaggaaagaaagggtttacgttccgggg
ttagggagatga

DBGET integrated database retrieval system