KEGG   Sulfolobus islandicus L.D.8.5: LD85_0497Help
Entry
LD85_0497         CDS       T01158                                 

Definition
glutamine amidotransferase, class-II
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sii00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sii00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(414768..416522)
Genome map
AA seq 584 aa AA seqDB search
MGGIFAFVCKDSIDVSIINKGLKKLIYRGYDSAGIAYLEDDSLVIKKILGNISKNEISVS
DKARVAIGHTRYASRGWPTLENAHPLTDCNGKIAVVMDGILDDYEKIREDLIAKGHKFVS
TTDAEVIPHLLENSTNYLNSSLNVMKRVKGIYSLVFVTIDIDKIFAINSGQPLMIGITQE
CKYVSSDLPSLSGFAENAIIMPENTVAVISWNDVQVYNIEGNEVKPEIKRVKYKEEIAEK
GGFPHFMLKEIYDIPQALINSFNSLMEKYLSLASMILYGAKNVYVIGNGTSLHAGLISTY
YFSEIGLNVNVVSAAEFPYYALENVTTGSVIIAISQSGETSDVIRSVKMAKQRGAVILGI
TNSVGSRLALESNVYLPITAGPEMAVPATKTFTSTIVVLKVLSLYTGLHSGKNSRSDINS
LKTEIEELAKQLVTSLPEMEKEAEKLSIKLDKESLYVSSSGINYPVALEGALKFKEASMT
HAEGMQLGELLHGPIVLTNKGYPVILIKPAEAEDLYNKVVKSIRERRDVIITISEDGDMK
SVKTIRDLTPISNIIPLQLLAYKLGVKRGFPIDTPPGLVKAVIV
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgggaggaattttcgctttcgtatgcaaggattccattgatgtttcaattattaacaag
ggtttaaagaagttgatttataggggatatgatagcgctggtattgcttaccttgaagac
gatagcttagtaataaagaaaattttaggtaatatctcaaagaatgagataagcgttagt
gacaaggcaagagttgcaataggtcacactagatatgcgagtaggggttggccaactttg
gaaaacgctcacccactgactgattgtaatgggaagatagcagttgtaatggacggtatt
cttgacgattacgaaaaaattagggaagatctgattgcgaagggacataaattcgtctct
acaactgacgctgaggtgattccccacttacttgagaattcaacaaactatctaaactca
tcattaaacgttatgaaaagggtaaagggcatttactctctggtttttgtaaccatagac
attgataaaatattcgcaattaactctggccaacccttgatgataggtatcacacaagag
tgtaaatacgtttctagcgatttaccctctttgagcggttttgctgagaatgcgataata
atgccagaaaatactgtggcagtaatctcttggaatgatgtgcaagtgtataatattgaa
ggtaatgaggtaaaaccggaaattaagagagttaaatacaaggaggagatagctgaaaag
ggtggatttccacacttcatgttaaaggagatatacgatatcccacaggccttgataaac
tcatttaactctttaatggagaagtacctttccttagcctcgatgatactatatggtgct
aaaaacgtttatgtgataggtaatggaaccagtcttcatgctggattaatctccacttac
tatttctcagaaatcggtctaaatgttaacgttgtaagtgcagcggaatttccatattat
gccttggaaaacgtaactactggttcagtaattattgccataagtcaaagtggagagacc
agtgatgttataaggagtgttaaaatggccaagcagagaggagctgtgatattaggcata
accaactccgtaggttcaagattggcattggagtctaacgtatacctaccaataaccgct
ggaccagagatggctgtgcctgcaaccaaaacttttacctcgactattgtggtacttaag
gtactttcactatatactggacttcactccgggaaaaatagtaggagtgacattaattca
ttaaaaaccgagatcgaggaattggctaaacagcttgttacgagtttaccggaaatggag
aaagaggcagagaaattgtctattaaactggataaggaaagcttatacgtttcaagtagt
gggataaattatcccgtagcattggaaggagctttgaaatttaaggaagcttcaatgact
cacgcagagggtatgcagttgggagagctcttgcatggtccaatcgttctcactaataaa
ggttatcccgtgattttaataaaacctgctgaggctgaggatttgtacaataaggttgtt
aagtcaataagggaaaggagggatgtgattataaccatttctgaagatggtgatatgaag
agtgtaaagacaattagggatttgactcctataagcaatataataccgttacagttatta
gcttataagctgggagttaagaggggtttcccaatagacactcctccgggactagtaaag
gctgtcatagtttaa

DBGET integrated database retrieval system