KEGG   Sulfolobus islandicus L.D.8.5: LD85_0497Help
Entry
LD85_0497         CDS       T01158                                 

Definition
glutamine amidotransferase, class-II
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LD85_0497
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LD85_0497
Enzymes [BR:sii01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     LD85_0497
Peptidases [BR:sii01002]
 Cysteine Peptidases
  Family C44
   LD85_0497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(414768..416522)
Genome map
AA seq 584 aa AA seqDB search
MGGIFAFVCKDSIDVSIINKGLKKLIYRGYDSAGIAYLEDDSLVIKKILGNISKNEISVS
DKARVAIGHTRYASRGWPTLENAHPLTDCNGKIAVVMDGILDDYEKIREDLIAKGHKFVS
TTDAEVIPHLLENSTNYLNSSLNVMKRVKGIYSLVFVTIDIDKIFAINSGQPLMIGITQE
CKYVSSDLPSLSGFAENAIIMPENTVAVISWNDVQVYNIEGNEVKPEIKRVKYKEEIAEK
GGFPHFMLKEIYDIPQALINSFNSLMEKYLSLASMILYGAKNVYVIGNGTSLHAGLISTY
YFSEIGLNVNVVSAAEFPYYALENVTTGSVIIAISQSGETSDVIRSVKMAKQRGAVILGI
TNSVGSRLALESNVYLPITAGPEMAVPATKTFTSTIVVLKVLSLYTGLHSGKNSRSDINS
LKTEIEELAKQLVTSLPEMEKEAEKLSIKLDKESLYVSSSGINYPVALEGALKFKEASMT
HAEGMQLGELLHGPIVLTNKGYPVILIKPAEAEDLYNKVVKSIRERRDVIITISEDGDMK
SVKTIRDLTPISNIIPLQLLAYKLGVKRGFPIDTPPGLVKAVIV
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgggaggaattttcgctttcgtatgcaaggattccattgatgtttcaattattaacaag
ggtttaaagaagttgatttataggggatatgatagcgctggtattgcttaccttgaagac
gatagcttagtaataaagaaaattttaggtaatatctcaaagaatgagataagcgttagt
gacaaggcaagagttgcaataggtcacactagatatgcgagtaggggttggccaactttg
gaaaacgctcacccactgactgattgtaatgggaagatagcagttgtaatggacggtatt
cttgacgattacgaaaaaattagggaagatctgattgcgaagggacataaattcgtctct
acaactgacgctgaggtgattccccacttacttgagaattcaacaaactatctaaactca
tcattaaacgttatgaaaagggtaaagggcatttactctctggtttttgtaaccatagac
attgataaaatattcgcaattaactctggccaacccttgatgataggtatcacacaagag
tgtaaatacgtttctagcgatttaccctctttgagcggttttgctgagaatgcgataata
atgccagaaaatactgtggcagtaatctcttggaatgatgtgcaagtgtataatattgaa
ggtaatgaggtaaaaccggaaattaagagagttaaatacaaggaggagatagctgaaaag
ggtggatttccacacttcatgttaaaggagatatacgatatcccacaggccttgataaac
tcatttaactctttaatggagaagtacctttccttagcctcgatgatactatatggtgct
aaaaacgtttatgtgataggtaatggaaccagtcttcatgctggattaatctccacttac
tatttctcagaaatcggtctaaatgttaacgttgtaagtgcagcggaatttccatattat
gccttggaaaacgtaactactggttcagtaattattgccataagtcaaagtggagagacc
agtgatgttataaggagtgttaaaatggccaagcagagaggagctgtgatattaggcata
accaactccgtaggttcaagattggcattggagtctaacgtatacctaccaataaccgct
ggaccagagatggctgtgcctgcaaccaaaacttttacctcgactattgtggtacttaag
gtactttcactatatactggacttcactccgggaaaaatagtaggagtgacattaattca
ttaaaaaccgagatcgaggaattggctaaacagcttgttacgagtttaccggaaatggag
aaagaggcagagaaattgtctattaaactggataaggaaagcttatacgtttcaagtagt
gggataaattatcccgtagcattggaaggagctttgaaatttaaggaagcttcaatgact
cacgcagagggtatgcagttgggagagctcttgcatggtccaatcgttctcactaataaa
ggttatcccgtgattttaataaaacctgctgaggctgaggatttgtacaataaggttgtt
aagtcaataagggaaaggagggatgtgattataaccatttctgaagatggtgatatgaag
agtgtaaagacaattagggatttgactcctataagcaatataataccgttacagttatta
gcttataagctgggagttaagaggggtttcccaatagacactcctccgggactagtaaag
gctgtcatagtttaa

DBGET integrated database retrieval system