KEGG   Sulfolobus islandicus L.D.8.5: LD85_0547Help
Entry
LD85_0547         CDS       T01158                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LD85_0547
Enzymes [BR:sii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LD85_0547
Exosome [BR:sii04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LD85_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(452381..453886)
Genome map
AA seq 501 aa AA seqDB search
MNTMSHKFVLALDEGTTSARAILFDSDLNIVNIGQYEFPQHYPQPGYVEHDPEEIWEAQM
LAVKKAISKIDAKQIVAIGITNQRETTVLWDAKSGKPVYNAIVWQDRRTSPITDWLKANY
FKMIKDKTGLVPDPYFSASKIKWILDNVPNVREKAERGEIKFGTLDTYLIWRLTNGKAHV
TDYSNASRTMLFNINKLECDREILELLKIPESILPEVKPSSEIYGYSEALGNLIPISGDA
GDQQAALFGQVAFNVGEIKATYGTGSFILMNIGNNPIRSENLLTTIAWGLEKNKATYALE
GSIFITGAAVQWFRDGLRAIDVSDEIEPLASNVEDNGGVYFVPAFVGLGAPYWDPYARGL
IIGITRGTTKAHIARAILESMAYQTRDVIEVMQKESGISINSLKVDGGAAKDNLLMQFQA
DILGIKVIRPKVMETTSMGVAMLAGLGVGLWNSLEELRSIWKVDKEFIPSMSEEKMRALY
SGWKEAVKRAMGWAKVVGGQV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaatactatgtcacataagtttgttctagccctagatgagggtactacaagtgctagg
gctatactcttcgatagtgacttaaacatagtaaacatagggcaatatgaattcccgcag
cactatcctcaacctggctatgtggaacatgaccctgaggaaatatgggaagctcaaatg
ttagccgtaaaaaaggctataagtaaaatagatgctaaacaaatagtagcaatagggata
acaaaccaaagggagacaacggtattatgggatgctaaaagcggtaaaccggtttacaat
gcaattgtatggcaggatagaagaacttctccaataacggactggctaaaagcaaattac
tttaaaatgataaaggacaaaactgggttagttccagacccttactttagtgcatctaag
ataaagtggatacttgataatgtgcccaatgttagggagaaagcagaaagaggagaaatt
aagttcgggaccctagatacttatttaatctggaggcttactaacggaaaagctcatgta
actgattactctaacgcttctagaacaatgctttttaatataaataaattagaatgtgat
agagaaatcttagaacttctaaaaatacccgaatctatattgccagaggttaaaccatca
agtgaaatttacggttacagtgaggcgttaggaaacttaatacctatatctggggacgca
ggagaccaacaagcagctttattcggtcaagtagcgtttaacgtaggtgagataaaagct
acttatggtaccggtagtttcattttaatgaatataggcaataacccaatacgatcagaa
aacctcttaactacaatagcttggggtcttgagaagaataaggcaacgtatgcattagag
gggagtatattcataactggtgcagctgtacaatggtttagggacggcttacgggcaata
gacgtttcagatgagattgaacctttagcctcaaatgtggaagataatggcggtgtctat
ttcgttccagcttttgttggattgggagctccttactgggatccatatgctagaggtctc
ataataggcataactagaggaactactaaagctcatatagctagggctattttagaatca
atggcctatcaaactagagatgtaattgaggtaatgcaaaaggaatccggcatcagtata
aattcgcttaaggttgacggaggtgcagctaaggataaccttttaatgcaattccaagct
gatatattaggtattaaggtaatcagacctaaagttatggaaactacttctatgggagtt
gcaatgctagcaggtttaggtgtaggcttatggaactctttagaggaattaaggagcata
tggaaggttgataaggaattcattccaagtatgagtgaggagaaaatgagggcattgtac
tctgggtggaaggaggctgtaaagagagctatgggatgggctaaagttgtaggaggtcaa
gtttaa

DBGET integrated database retrieval system