KEGG   Sulfolobus islandicus L.D.8.5: LD85_0554Help
Entry
LD85_0554         CDS       T01158                                 

Definition
Medium-chain-fatty-acid--CoA ligase
Orthology
K14466  
4-hydroxybutyryl-CoA synthetase (4-hydroxybutyrate-CoA ligase, AMP-forming) [EC:6.2.1.-]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LD85_0554
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LD85_0554
Enzymes [BR:sii01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     LD85_0554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(459071..460495)
Genome map
AA seq 474 aa AA seqDB search
MSSVKNEYDAIHRELREQGFIRTDYPPNPSEVLWNKKIMTMKREEIDKLKTFRLRRIIKW
AWENIEFYRRFWKSKNFEPDMIKDWRDIAKIPILRKDEIRKDLQQNPPFGTIFHPELANH
IRFVGATSGSTGLPTFQGWGALEMDYFQEAQARYLWTFAEVKPTKVYANYLNMSGFYSWG
PPVVETAMWRCGATVIAGGGETYFSWKNRHNLIFKLWKVDVFATTPWLHRLVGEEAKIEG
WETPFKVLLLHGGAAAENTKKKLFKVHPNAELAISVWGTTDGHMAIEVPSLEGQLVVWED
MEIFDIVDPKTDEPVSGGERGELIATLLNHFTMPLIRYSLGDYVKNDFLTDPDPKYGITH
MRFAEPIPGRVEWMFFVKGKLLLPIYVEDAVNEIPDTTGMFNIFIYDNSMDKLKIRIETR
REQVNSTYDKQAREILASRIGINPDDVEIEWVKPGNTIWTGYKLQVFVDQRKKK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagttaaaaacgaatacgatgcaattcatagggaattacgagaacaaggtttt
attagaactgattatcccccaaatccatctgaagtgttatggaataagaagataatgaca
atgaaaagagaggaaatcgataagttaaagacgtttagactaagaaggattataaagtgg
gcatgggaaaacattgagttctatagaaggttttggaaatctaaaaacttcgaaccagat
atgataaaggactggagggatatcgctaaaataccgatattgagaaaagatgaaattagg
aaagacctacagcaaaatcctccatttggtacaattttccatccagaattggctaatcac
ataagatttgttggagcgacttctggctcaactggattacctaccttccaaggatggggg
gctttggaaatggactacttccaagaagcccaggcaaggtacttgtggacttttgccgaa
gttaagccaactaaggtttacgcaaactacctaaacatgagtggcttttatagttggggg
cctccggttgttgagaccgcaatgtggagatgtggggcaactgtcatagctggaggtggt
gagacatacttctcatggaagaatagacacaacctgatcttcaaactatggaaagttgac
gtattcgccacaactccttggctacatagattagtaggagaggaggctaaaattgagggt
tgggaaactcccttcaaggttttgctacttcacggtggtgcagctgctgaaaacactaaa
aagaaattattcaaggttcatccaaatgctgaattagctataagtgtttggggaaccact
gatggacatatggctattgaagttccaagcttagaaggacaattagtagtttgggaggac
atggagatatttgatattgtagaccctaagactgatgaaccagtatctgggggagaaaga
ggtgaactgatagcgaccttgttaaatcactttaccatgcctttaatacgctatagttta
ggagattacgttaagaatgacttcctgaccgatccggatcctaagtatggtataactcac
atgagatttgctgagccaataccaggtagggttgagtggatgttcttcgttaaagggaaa
ctattattgccaatttacgttgaggacgctgtgaatgaaattccagacactactggaatg
tttaacattttcatttacgataatagtatggataaattgaagattagaatagagacaagg
agggaacaggttaattctacttacgataagcaagccagagagatattagcgagcaggatt
gggattaacccagatgacgttgagatagagtgggtaaagcctggaaatacaatatggacg
ggctacaagttgcaagtgtttgttgaccagaggaagaagaaataa

DBGET integrated database retrieval system