KEGG   Sulfolobus islandicus L.D.8.5: LD85_0645Help
Entry
LD85_0645         CDS       T01158                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LD85_0645
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LD85_0645
   00630 Glyoxylate and dicarboxylate metabolism
    LD85_0645
Enzymes [BR:sii01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     LD85_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(545544..548021)
Genome map
AA seq 825 aa AA seqDB search
MSFGLKISEEVYQKYSDLFGEKTINDRIVSVEKLIEELAVEFSDEIRRVINKRRQWLESK
DPVTSKGAFPSFDEVFVDADGNKRTFREIIQGMIDNFLGVQSKLRWRLNENVPIPKDAHP
LNNPGLEITGPWYPLSRAYNQINSDVACVMEDEEDASPAWYIPFGSGKTTADVWEGRKNV
KLFLSGKAPNPYYEKGKTYSLNKPRDKWPVIFHRLPGLHLLDFDITLNGKPVPAIIVSAV
IYTLNNYNSLKSAGSGVYFYLPKTQTPDEALVIEKILRRIESKLGLKIGTLKIALLYEEV
NAGRFFPIILWIFRERLIKSNNGRWDYLGSLIEMWLQEKVLPDPQNITMTSPNMMAYQKY
NALMMLLAGAKNGEADSAPVGGMAAVMLYPQTDPFGRNRYNLKALRGMKLDKLRERLIGL
IFVAEDKVEGKVTLEEVINGEVKGKLYDMFRQSWVATKEEAYVEAGSKPLRVSLEELQKI
IDAPVNYIEVEGTKLPTVDSGLTPEERALFQKLGLINERGKITPWVITKEMINTPEKLLF
NKELWGGKDLWHSLYDIPEGDITPEHVQHAFYMAANYGFQLLNGNLAAAIDDYELKQRFM
NDLATYRIFTSWLWSVINRDASFTKDGYIKGPKLTKDGVIPAEDVLKVTKGTKIKDIVEK
LWELHLDWTYEFYKEQDMRAARKIAETFRKTNNTSTVEEVYKVVSEAYRSGPFREMSAKE
AAQKLAKILNADASEIEEELINLAPRFDRAMAPVIMEILMKQMLYPKYIMNSGKILFILS
PLDPERRSKVMDSIFSFRKMVEDKVRKGELDKWVLELYDYVYDNY
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttggccttaaaatctctgaagaggtatatcaaaagtatagtgacctcttcgga
gaaaagaccataaacgataggattgtaagtgtcgaaaaactcattgaagagcttgcagtt
gagttctcggatgagataagaagggttattaataaaaggagacaatggttagaatcaaaa
gatcccgttacctctaagggtgctttcccatccttcgacgaagtttttgtagacgctgat
ggaaataagagaacctttagggaaatcattcaagggatgatagacaatttcctaggagta
cagtcgaagctgaggtggaggttaaatgaaaatgtacctataccaaaagacgcacacccc
cttaataacccgggattagaaatcactggaccttggtatcctctaagtagggcatataat
caaataaattcagacgtggcatgtgttatggaagatgaggaagatgcttcacccgcatgg
tatattccctttggttctggtaaaacaactgctgacgtatgggagggaagaaagaacgta
aaactctttctctccggtaaggctccaaatccttactacgagaaggggaaaacgtatagc
ctaaacaaacctagagataagtggcctgtgatttttcacagacttcctggattgcacctc
ttggattttgacataacgctaaatggtaaaccagtaccggctataattgtttctgccgtc
atatataccctaaataattacaatagcctaaagagcgcaggctctggggtatatttctat
ctgcctaaaacacagacaccggatgaggcattggtaatagaaaagatcttgagaagaatt
gagtctaaactagggcttaagataggtacacttaagatcgctctcctttacgaagaggtt
aatgcgggaagatttttccctataatactgtggatatttcgtgagaggctcattaaatca
aataacggtagatgggactacttgggaagtttaattgagatgtggttacaagagaaagta
cttcccgatccccaaaacattaccatgacctcaccaaacatgatggcttatcaaaagtat
aacgcacttatgatgctattggctggggcaaagaatggtgaagccgattcagctccagta
ggtggtatggcagcagtaatgctttatcctcaaactgatccgttcgggagaaatagatac
aacttaaaggcattaaggggaatgaagttagataagttaagagagaggctaatagggctt
atttttgtagcagaggataaagttgaaggtaaagttactttagaggaggtaattaatggc
gaagtaaagggtaaactttatgatatgtttagacagagttgggttgcaaccaaggaagag
gcttacgtagaggcggggagtaaacctttaagggtaagcctagaggaattacagaaaata
attgatgcaccagttaactatattgaagtagagggaaccaaattacctactgtggatagt
ggactaacaccagaggaaagagcattattccaaaaacttggtctaattaatgaaagagga
aaaataacaccttgggttataactaaggaaatgattaacactcccgaaaagttactattt
aataaggaattatggggtggaaaagacctatggcattcgttatatgacatcccagaggga
gacattacaccggagcatgttcaacacgcattctatatggcagcaaattatggtttccaa
ttgcttaatggtaacttagctgcagcaatagatgattatgaattaaagcaaagattcatg
aatgatctagctacctatagaatattcacttcttggctatggagtgtgataaatagagac
gctagcttcacaaaggatggatatattaagggaccaaagttaactaaggacggtgtaatt
ccagctgaagatgttctaaaggttacaaaggggactaagataaaggacatagtcgagaag
ttatgggagttacacttagattggacatatgagttttacaaagaacaagatatgagagca
gctaggaaaatagcggaaacctttagaaagacaaataatacttccacagtagaagaggta
tataaggtagtttccgaggcttataggtcaggtccgtttagagaaatgtcggctaaagaa
gctgcacagaagttggcaaaaattcttaacgctgacgcctctgagatcgaggaagagctt
attaatttagccccaaggtttgacagagctatggctccagtaataatggaaattttaatg
aaacagatgctatatcccaagtacattatgaatagtgggaagattctcttcatactatcg
ccgttagatccagagaggaggtcaaaggtcatggatagtatattctcgtttagaaaaatg
gttgaagataaggtaagaaaaggagaactagataagtgggtattggagttatatgactat
gtttatgataattactga

DBGET integrated database retrieval system