KEGG   Sulfolobus islandicus L.D.8.5: LD85_0650Help
Entry
LD85_0650         CDS       T01158                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LD85_0650
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LD85_0650
   00620 Pyruvate metabolism
    LD85_0650
   00640 Propanoate metabolism
    LD85_0650
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LD85_0650
   00680 Methane metabolism
    LD85_0650
Enzymes [BR:sii01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LD85_0650
Lipid biosynthesis proteins [BR:sii01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LD85_0650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(551932..553566)
Genome map
AA seq 544 aa AA seqDB search
MLEVDLREIRFHSYDELVRTFKWNIPSHFNIGESILDRKIKEGLGDNIAIYYEDEEGNHF
AYTFTQLKNLSDSLITILREIGVKRGDVVGIYLQPRVETVISILSLYRLGAISLSISPLM
GVESVEYRIRQSDAKAIIIEGSRREVRQKLRNITKIIVADSARDESEINFDEVKRTSGVY
YAVDTKSDEPAQLFYTSGSTGAPKGVLHAHRFLLGHIPAYQLYFEMAPKEEDVFYTPADW
GWIGAIGDVLLPSLYFGKPIVAYRRLGKFSPKDALAIMQKYKVTCAFIPPTALRMIRREV
INPRRDYDLRLRAISSAGEAVGEDLLEWAIKKLSPNVNEFYGCTEANLVTVNNSMWRKIG
SIGKATPGHEIAVIDEKGNKVINQVGEIAVRMEDPVLFLGYYKDPEATAKKFRGYWFLMG
DLGLMDQNGYIWFKGRGDDVIKVSGYRLGPEEIESVILQHSAVQEVAVIGKQDKLRGNII
KAFIVLKDGYLPSDNLVQEIQEFVKNRLALYAYPREIEFVKELPRTETGKLKRFELRKKE
EEKS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaggtagatttgagagaaattagatttcatagttatgatgagctcgtaagaaca
ttcaaatggaatattccatcacactttaatataggagaatcgatattagacagaaagatt
aaggaagggttaggagataacatcgcaatatactatgaagacgaggaaggtaatcatttt
gcttatactttcactcaattgaagaatcttagcgattctttaataacaattttaagagaa
ataggagtaaaaagaggggatgtcgttggtatttacttacagcctagggtggaaactgta
ataagtattttatcgctatatagacttggagcaattagtttgtcgatttcaccattaatg
ggtgtagagtctgttgaatatagaataaggcaaagtgatgccaaggccataataattgaa
ggttcaagaagagaggttagacagaaattaaggaatataactaagatcatagttgctgat
agtgctagagatgaaagtgaaattaatttcgatgaagttaaaaggacctctggagtgtac
tatgcggtagatactaagagcgatgaaccagcccagctcttttatacatctggtagtact
ggggcaccaaagggagtccttcatgctcacaggtttctgttgggacatattccagcttat
cagctctattttgaaatggcaccaaaagaagaggatgtattttacacgcccgcagattgg
ggttggattggagctataggtgacgtgctattgcctagcctctattttgggaagccaata
gtagcatatagacggctagggaaattctcacctaaagacgcactagccataatgcagaaa
tataaagttacttgtgctttcatccctcctactgctttaagaatgattagaagggaagtt
attaatccaaggagagattatgacttaagattaagggcaattagtagtgctggagaggct
gtgggagaggatctgcttgagtgggcaatcaaaaaattgtctcctaatgttaatgaattt
tatggctgtacagaggctaatttagttaccgtaaataactccatgtggcgtaagatagga
tctataggcaaagctactcctggtcatgagatagcagttattgatgaaaaaggcaataag
gtaataaatcaagtgggagaaatagcagtaaggatggaagacccagtattgtttctagga
tattacaaggatccagaagctactgctaagaagtttaggggatattggttcttaatggga
gatctaggtttaatggatcaaaatgggtatatttggtttaaagggagaggagacgacgta
ataaaggtttctggatatagattaggaccggaggagatagagagcgtaatattacaacat
tccgcagttcaagaagttgcggtaataggtaagcaagataagttgagaggaaatataatt
aaggcatttatagtactaaaggatggatatttgccatctgataacttagtacaagaaatt
caggaatttgtaaaaaatagactagctttatatgcatatcctagagaaatagaattcgtt
aaggaattacctagaaccgagactggtaaattaaagagatttgagctaagaaaaaaagaa
gaagaaaaaagttga

DBGET integrated database retrieval system