KEGG   Sulfolobus islandicus L.D.8.5: LD85_0734Help
Entry
LD85_0734         CDS       T01158                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LD85_0734
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LD85_0734
   00620 Pyruvate metabolism
    LD85_0734
   00640 Propanoate metabolism
    LD85_0734
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LD85_0734
   00680 Methane metabolism
    LD85_0734
Enzymes [BR:sii01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LD85_0734
Lipid biosynthesis proteins [BR:sii01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LD85_0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
615617..617485
Genome map
AA seq 622 aa AA seqDB search
MSWKIYSLDQIKALAKFSMENPEAFWRDKANYITWFRQPEKILEGEPPYEKWFVGGTTNI
SYNAIDRHLPDKKDKVAFYWTNERLDSFRSISFQDLYQEVNKAAYVLSELGVKKGDTVSM
LMPNIPEAVYFSLATHRLGAILIIHYVGLSEETVAYRFNDCGSKVLIVASKTFRNGNEIR
IKDFVDKVLESHTTPIQKVLAVPRGYSDFNVNGKRDVVYDDVKPKGKVYVKPVEVEANEP
ATVYYTSGTTGRPKGLYHSNGGYVIALNWAFKAIFNPTENDVWWTVSELGWPVWPMANLY
TIPVMGIPGVLFEGYVGYKRDLFSRVIERYNVSLVWSSTTTLYTLKSLGEESVKSGDTSS
LRMILNTGEPLNVGAWMWLNQNLPQVKIADAYWMTEHLSPVGATPYGIGEIPFKAGSAGI
QFPGGTYFLIVDDEGKPLPPKQKGYIVLKPLNPALAKMWNDPNYEKIKEKYWSRFPGYFY
TGDYGYVDEDGYLFVLGRADDVIRAEGERIGTLEVESVIVTHPNVAEAAVIGQGGNIIAF
VVPRQGVEVGDALRNDIKNYCRNAGYIVDKVVFVKRLPKTKSGKIMRRLLKAILANENPG
DVSTLDDIRIMEELKEALKSLS
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagttggaaaatatattctctagatcagattaaagcattggcgaaattctctatggaa
aatccagaagccttctggcgagataaggctaattacataacttggtttaggcaaccagag
aaaatacttgagggagaaccaccgtacgagaagtggttcgttggaggaaccacaaatata
tcctataacgctatagataggcatttaccagataagaaagataaggtggcattttattgg
accaatgaaagattagatagttttaggtcaatatcctttcaagatctttatcaagaagta
aacaaggcagcctatgtcttaagtgaattgggcgtgaaaaaaggcgatacggtatccatg
ctaatgcctaatataccagaagctgtatacttctcattagcaacacacagactgggggca
attctaataatacattatgtaggtttgagcgaggaaacagtggcatataggtttaatgat
tgcggttcaaaagtattgattgttgcttcaaagacgtttaggaatggaaatgagataaga
attaaggattttgtggataaagttttggaatctcatactacacccatacagaaagtcttg
gcagtgccgaggggatattcagattttaatgttaatgggaaaagggatgttgtgtatgat
gatgtgaaacctaaagggaaagtttacgttaaaccagtggaagttgaggctaacgagcca
gcgacagtttattacacgtctggaactacgggaagacctaagggattataccatagtaat
ggaggatatgtgatagcactcaattgggcttttaaggcaatatttaacccaacagagaat
gacgtttggtggactgtttcagaattaggttggccagtatggccaatggcaaatttatac
acgataccagtaatgggaatacctggtgtgctttttgagggatatgttggttataaaagg
gatctattctcgagagtaattgagagatataatgtaagcctagtttggagttctaccaca
actctttacactctcaagagtttaggagaggagtcagttaagagcggagatacatcaagc
ttaagaatgattcttaatacaggagaacctttaaacgttggagcgtggatgtggttaaat
cagaatcttcctcaagttaagatagcagatgcgtactggatgacagagcatttatcgcca
gttggtgcaactccttacggaatcggcgaaattccctttaaggcaggttccgctggtata
caattcccaggaggaacatatttcttaattgttgacgatgagggaaaaccattacctcct
aagcaaaaggggtatatagtgttaaaaccgcttaacccagccttagctaaaatgtggaat
gatcccaattacgagaagataaaggagaagtattggtctaggttcccaggatacttctac
actggagattacggttatgttgatgaggatggatatctgttcgtgctgggaagagctgat
gatgtaataagagctgaaggggagaggataggaacacttgaagttgaaagtgtaatagta
actcatcccaacgtggccgaagctgccgtaataggtcaaggcggtaacataatagcgttt
gtagtcccaagacaaggggttgaggttggtgacgcactcagaaatgacattaagaactat
tgtaggaacgctggttacatagttgataaagtagtgtttgtgaagagactgcctaaaacc
aaaagcgggaagataatgagaaggctactaaaggctatcctagctaacgagaatccaggt
gatgtatcaacattggacgatataaggataatggaggaacttaaggaagcgttgaagagc
ctaagctaa

DBGET integrated database retrieval system