KEGG   Sulfolobus islandicus L.D.8.5: LD85_0877Help
Entry
LD85_0877         CDS       T01158                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
sii00521  Streptomycin biosynthesis
sii00523  Polyketide sugar unit biosynthesis
sii01130  Biosynthesis of antibiotics
Module
sii_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LD85_0877
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LD85_0877
Enzymes [BR:sii01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LD85_0877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADB86587
UniProt: D2PI93
Position
737920..738450
Genome map
AA seq 176 aa AA seqDB search
MPFEFENLGMGIVLIKPKVFPDKRGFFLEVFKSEDFTKAEIPNIVQTNMSFSFKGVVRGL
HYQITPKEQGKLVFVPKGKILDVAVDLRKSSPTFGKYVKVELNDENHYILWIPPGFAHGF
QALEDSIVVYFLTHNEYSKSDERCVNYSYVDWPIKEFIISDKDSQCPPLEKADVFN
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgaatttgaaaacttaggaatgggtattgtcctcataaagccgaaagtcttc
ccagataaaagaggcttctttcttgaagtatttaaatctgaagacttcactaaagcagaa
attcctaatatcgtacaaactaatatgtcattctcttttaaaggagtagttagaggtcta
cactatcagataactcccaaggaacaaggtaagttagtatttgttcctaaaggtaaaata
ttggatgttgctgtagacctaagaaaatcatcccctactttcgggaaatacgttaaagtt
gagcttaacgatgagaaccactacatactatggatacctccaggttttgcccatggattt
caagcattagaagattcaatagtagtctacttcctaacccataacgaatactctaaatct
gacgagagatgcgtaaactactcttatgtagactggccaataaaggaatttattataagc
gataaggactcacagtgcccgcccttagaaaaggcagacgtctttaattaa

DBGET integrated database retrieval system