KEGG   Sulfolobus islandicus L.D.8.5: LD85_0877Help
Entry
LD85_0877         CDS       T01158                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:sii00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sii00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
737920..738450
Genome map
AA seq 176 aa AA seqDB search
MPFEFENLGMGIVLIKPKVFPDKRGFFLEVFKSEDFTKAEIPNIVQTNMSFSFKGVVRGL
HYQITPKEQGKLVFVPKGKILDVAVDLRKSSPTFGKYVKVELNDENHYILWIPPGFAHGF
QALEDSIVVYFLTHNEYSKSDERCVNYSYVDWPIKEFIISDKDSQCPPLEKADVFN
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgaatttgaaaacttaggaatgggtattgtcctcataaagccgaaagtcttc
ccagataaaagaggcttctttcttgaagtatttaaatctgaagacttcactaaagcagaa
attcctaatatcgtacaaactaatatgtcattctcttttaaaggagtagttagaggtcta
cactatcagataactcccaaggaacaaggtaagttagtatttgttcctaaaggtaaaata
ttggatgttgctgtagacctaagaaaatcatcccctactttcgggaaatacgttaaagtt
gagcttaacgatgagaaccactacatactatggatacctccaggttttgcccatggattt
caagcattagaagattcaatagtagtctacttcctaacccataacgaatactctaaatct
gacgagagatgcgtaaactactcttatgtagactggccaataaaggaatttattataagc
gataaggactcacagtgcccgcccttagaaaaggcagacgtctttaattaa

DBGET integrated database retrieval system