KEGG   Sulfolobus islandicus L.D.8.5: LD85_0979Help
Entry
LD85_0979         CDS       T01158                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LD85_0979
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LD85_0979
  Lipid metabolism
   00071 Fatty acid degradation
    LD85_0979
  Amino acid metabolism
   00350 Tyrosine metabolism
    LD85_0979
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LD85_0979
   00626 Naphthalene degradation
    LD85_0979
Enzymes [BR:sii01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LD85_0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(836902..837939)
Genome map
AA seq 345 aa AA seqDB search
MKAMKIVEFGKPLELSEVGEITKTKSNQVLIRVQAAGVCHTDVSVRSGVIYKRISANPPR
LPLTPGHEIVGIVEEVGDEVTGFTKGDKVLINPWQGEGNCFYCKIGEDQYCDSPTWLGIT
TDGGFQEYVLSNHNYVYKIRNLSPYEAAPLACAGVTSYRASKLARLNPSSYVAIIGAGGG
LGSIGVQIIRALYGSIIIAIDVNDEGLELASKFGADYTLNSRRKEVYQEVLKITNGRGVD
AIIDFVGSENTIKSYYTFLAKLGRYIKVGTFGGGLPNEAGLKIHSMGWQFIGTLTGNRKE
FLEVISLAENGRIKPVVTKLRLEEANEALDNLERNKVTGRQVLIP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgaaaattgttgagtttggaaaaccattagagctatcagaggttggtgag
attactaagactaaatcaaatcaagtattaataagagtccaagcagctggagtatgccac
acagacgtttcagtgagaagtggggtaatttacaagaggattagtgcaaatccaccaaga
cttccgcttacacccgggcatgaaatagttgggattgtagaggaagttggagatgaagtt
accggattcactaagggtgacaaagttctcataaatccctggcaaggtgagggaaattgc
ttctactgcaaaataggagaagaccagtactgtgactcgcctacgtggttgggtattacg
actgatgggggttttcaagaatacgtactatccaaccacaattatgtatataagataaga
aatctctcaccttatgaggcagcaccattagcttgtgctggggttacatcatatagggca
agtaaactagctaggttaaatccatccagctacgtagctataataggagccggaggaggg
ttaggaagtattggagtgcaaataatcagagcactttatggttccataattatagctata
gacgtcaacgatgagggactagaactcgcctcaaagttcggagctgactacactttaaac
agtagaagaaaagaagtatatcaagaggtacttaaaataacgaatggaaggggtgtagat
gccataatagatttcgtaggctcagaaaacacgatcaaaagttactatacctttttagct
aaattaggaaggtacatcaaagtaggaacctttggcggaggtctacccaatgaggctgga
ttaaaaatacactcaatgggatggcaattcataggtacactaactggaaacagaaaggaa
tttttggaagtcataagccttgcggaaaacggtaggataaaaccagttgttactaagtta
aggttggaggaagcaaatgaggcattggacaacttggaaagaaataaggtaactggaaga
caagtattaataccttaa

DBGET integrated database retrieval system