KEGG   Sulfolobus islandicus L.D.8.5: LD85_1040Help
Entry
LD85_1040         CDS       T01158                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
sii00010  Glycolysis / Gluconeogenesis
sii00620  Pyruvate metabolism
sii00640  Propanoate metabolism
sii00680  Methane metabolism
sii00720  Carbon fixation pathways in prokaryotes
sii01100  Metabolic pathways
sii01110  Biosynthesis of secondary metabolites
sii01120  Microbial metabolism in diverse environments
sii01130  Biosynthesis of antibiotics
sii01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LD85_1040
   00620 Pyruvate metabolism
    LD85_1040
   00640 Propanoate metabolism
    LD85_1040
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LD85_1040
   00680 Methane metabolism
    LD85_1040
Enzymes [BR:sii01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LD85_1040
Lipid biosynthesis proteins [BR:sii01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LD85_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADB86729
UniProt: D2PIX6
Position
898889..900436
Genome map
AA seq 515 aa AA seqDB search
MKYEELVRNFSWNEVKNYFGKDFRDKLIRDSSDTAVFRVDSKWDKESLSYSQLKDKAQRL
SAFLRHQFKVKKGDVVACLASKKVEQVVYLVSSWILGVIYEPLFTAFGPAAIEMRTRDRK
PKVILAQDDQYDKIKDMFNNIITFPGKTGNSVSLDEAISYDMLRREEWEKISYDDPSGLQ
YTSGTTGRPKGALQNFRTLYSLYVYIKYGIGLREDDVFWTPADPGWAYGLGVGIISPIIF
GKTVIFFDKLFSPEDTLKFIEDFKISNFAFVPTAYRMIMGTVKEPKKFNLRITRASSAGE
PLNPEVIRWFKENLGFMIKDHYGQTESGMVVYNGWGYEADVKPGSMGLPAPGYQVTVIDG
VIAVNKNCEGFYFLGYINDEERTKKVFKGDWYLTGDAAEIDKDGYFWFIGREDEVIKVSG
YRASPFEIESVLIQHPAIMEAAVIGVDDPVKGKIIKAYVVLKPNYKPSSDLANEIINFVR
EKYSRHAYPREVKFVTSLPKTESGKIQKYKLKELG
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgaagaattagtcagaaattttagttggaatgaggtaaaaaattactttggc
aaggattttagggataagttaataagggatagtagcgatacagcagtattcagagtagat
agtaaatgggataaggaatccctatcatactcccaattaaaagacaaagctcagagacta
agtgcgtttttaagacatcaatttaaggtaaagaaaggtgacgtagtagcttgtctagca
tctaagaaagttgaacaagtagtttatttagtttctagctggatattaggagtaatatat
gagcctttattcacggctttcggacctgctgcaatagagatgaggactagagatagaaag
cctaaagttatactagcacaagatgatcagtacgataaaatcaaggacatgttcaataat
ataattacatttccaggaaagacaggaaattctgtatcccttgatgaagccatatcttat
gatatgttgaggagagaggaatgggagaagatctcatacgacgatccctctggcttacaa
tacacttctggtactacggggaggcctaagggagcattacaaaacttcagaacactttat
agcctatatgtttacataaagtacggtattggtttaagagaagatgacgtattctggact
ccagcagacccaggttgggcttatggcctcggagtagggataatatctcctataatattc
gggaaaactgtaatatttttcgataagctattctctcctgaagatactctgaaattcatt
gaagattttaaaatttctaatttcgctttcgtgccaactgcttataggatgataatggga
actgtaaaagagcctaaaaaatttaacttaaggattactagagctagctctgcaggagaa
ccattaaatccagaagttataaggtggtttaaggaaaatttaggcttcatgatcaaggac
cattacggtcaaactgaatctggaatggtagtttataacggctggggttatgaggctgac
gttaaaccgggcagtatgggattacctgcaccaggatatcaagtcactgtaatcgatgga
gtaatagcagttaacaagaattgtgagggattctatttcttaggttatataaatgacgaa
gagagaactaagaaggtatttaaaggagattggtatttaaccggtgatgcggcagaaata
gataaggatgggtacttctggttcatcgggagagaggatgaggtaataaaggtgtcagga
tatagggcgagtccatttgaaatagaaagtgttctaatacaacatcctgcaattatggaa
gcagcggtaataggagtagatgacccagttaagggaaagataattaaagcttacgtagtt
ttaaagccaaattataagccctcaagtgatttagcgaatgagataattaacttcgtaagg
gaaaagtactcaagacatgcatatccaagggaagtgaaattcgttacctcacttcctaag
actgagagcggtaaaatacaaaaatataagctgaaagaattaggatga

DBGET integrated database retrieval system