KEGG   Sulfolobus islandicus L.D.8.5: LD85_1085Help
Entry
LD85_1085         CDS       T01158                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LD85_1085
   00052 Galactose metabolism
    LD85_1085
   00500 Starch and sucrose metabolism
    LD85_1085
   00520 Amino sugar and nucleotide sugar metabolism
    LD85_1085
Enzymes [BR:sii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LD85_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(934863..935624)
Genome map
AA seq 253 aa AA seqDB search
MAVITAAGLGTRMLPFTKEIPKEMLPIISNGEIKPIIQVIFEQLFSQGIRDFVFVVSRNK
RVIEDYFTPDYNFVDYLESVGKVKQAESLKGFYQLLEQSNIAFVNQFEQKGFGHAVLVAK
PYVNGDFLVVAPDTLVGDLDLSKLRVNSFLVTVVNDPRPYGVVVVKDGKVIDVEEKPKVP
KSNLIIVPYYHFDETIFSALEKVSYEGELQLTYAIKLLLNEGVEFSAVEVKEVYDLGNFN
GYVEYLKNLIKKI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcagttatcacagctgcgggtctaggcacaagaatgctaccgtttactaaggagatc
cctaaggagatgttaccaattatttctaatggagagataaagccaataatacaggtcatc
tttgaacaattattttcccaaggaataagggatttcgtctttgtagtaagtaggaataaa
agagtgatagaagactactttactccagactacaattttgtcgattatttggaatcagta
gggaaagtaaaacaagcggagagtttaaagggattttatcagcttcttgagcagagtaat
attgcatttgttaatcagtttgaacaaaaaggatttggtcatgcagtactagtagctaag
ccttatgttaacggtgattttttagtagttgctcctgacacattagtaggagatttggac
ttgtccaagttgcgtgtaaactcttttctagttaccgttgttaatgatccaaggccctat
ggtgttgtagtagttaaagacggtaaagtaatagatgttgaagagaaaccaaaggtacct
aagtctaacttgataattgtaccttactatcactttgatgagacaattttctcagccctg
gagaaagtcagttatgaaggcgaacttcagttgacttatgctattaaacttttattaaat
gagggagttgaatttagtgctgtagaagtaaaagaagtttatgatttaggtaattttaac
ggatatgtcgaatatttgaaaaacttaatcaaaaagatctga

DBGET integrated database retrieval system