KEGG   Sulfolobus islandicus L.D.8.5: LD85_1443Help
Entry
LD85_1443         CDS       T01158                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
sii00260  Glycine, serine and threonine metabolism
sii00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sii01100  Metabolic pathways
sii01110  Biosynthesis of secondary metabolites
sii01130  Biosynthesis of antibiotics
sii01230  Biosynthesis of amino acids
Module
sii_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LD85_1443
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LD85_1443
Enzymes [BR:sii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LD85_1443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NMO TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ADB87111
UniProt: D2PK08
Position
complement(1274555..1275286)
Genome map
AA seq 243 aa AA seqDB search
MGKLLVVYMTLGYPNVQSFKDFIIGAVENGADILELGIPPKYAKYDGPVIRKSYDKVKGL
DIWPLITDIRKDVSVPIIALTYLEDWIDQLDNFLNMMRDVKLDGVLFPDLLIDYIDDLDK
FDGIIKNKGLKNVIFTSPSVPDLLIHKVSKISDLFLYYGVRPTTGVPIPVSVKQLINRVR
NLVENKLIVGFGLSSESDLRDTLSSGADGIAIGTAFIEEIEKNGVKSAINLVKKFRVILD
EYK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaactgcttgtcgtttatatgacgttaggttatcctaatgttcaaagtttcaag
gattttattattggggcagttgaaaatggagctgacatattagagcttggaattccccct
aaatatgccaagtacgatggtccagttataaggaagagttatgataaagttaaagggcta
gatatttggcctttaataacagatattaggaaagatgtcagtgttcctataattgcactt
acttacttagaggattggattgatcaactagataattttctaaatatgatgagagatgtc
aaactggatggagttctatttccagatttacttattgattatatagatgatttggataaa
tttgacggaataataaaaaataaaggattaaaaaatgttatttttacatctccttcagta
ccagatcttctaatccacaaagtctctaagattagcgatttattcttatattatggtgtt
agaccaactactggcgtacctataccagtatcagttaagcagttgattaatagagttaga
aatctagttgagaataagctaatagtgggatttggcctatcaagtgagtcagatttaaga
gataccttaagttctggtgccgacggaatagcaattggaactgctttcatagaagaaatt
gaaaagaatggcgtaaaatcagcaataaatttagttaaaaaatttagggtgatattagat
gaatataaatga

DBGET integrated database retrieval system