KEGG   Sulfolobus islandicus L.D.8.5: LD85_1444Help
Entry
LD85_1444         CDS       T01158                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LD85_1444
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LD85_1444
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LD85_1444
Enzymes [BR:sii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LD85_1444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1275279..1276556)
Genome map
AA seq 425 aa AA seqDB search
MVKEDEILPKYWYNIIPDLPKPLPPPRDPQGADFSRIDLLRSILPKEVLRQQFTIERYIK
IPEEVRDRYLSIGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAK
EEGIDHVVTETGAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYAS
PTNLTEYGKKILETNPQHPGSLGIAMSEAIEYALKNEFRYLVGSVLDVVLLHQSVIGQET
ITQLDLLGEDADILIGCVGGGSNFGGFTYPFIGNKKGKRYIAVSSAEIPKFSKGEYKYDF
PDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLSLLAKEGIVEWREYNEREIFDA
AKIFMENQGIVPAPESAHAIKAVVDEAIEARKNNERKVIVFNLSGHGLLDLSNYESMMKR
LNGNG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagacgagattttgcctaagtactggtacaatataattcccgatctgcct
aaacccttgcctcctccaagggatccacaaggggcagatttctcgagaattgatttatta
agaagtatactacctaaggaggtattaaggcaacaattcacaatagaaagatacataaag
atccctgaggaagtaagagatagatatttatcgataggaagaccaacaccattatttaga
gctaaaagattagaggagtacttaaagacaccagcaagaatctactttaaatatgaaggc
gctacacctactggatctcataagataaatacagcaattcctcaagcatatttcgcaaaa
gaagagggaattgatcacgtagttactgaaactggagcaggtcaatggggaactgcagta
gcacttgcagctagtatgtataatatgaaaagtactatcttcatggtaaaggtaagttat
gaacaaaaaccgatgagaaggagcataatgcaattatatggggctaatgtttatgcaagc
cccacaaacttaaccgaatacggtaagaagatattagagacaaatccacagcatcctgga
tcactaggtatagcaatgagtgaggcaatagagtatgctcttaagaacgaatttagatat
ttagtaggtagcgttttagatgtagtacttttgcatcaaagcgttattggtcaagagact
attacccaattggatttgttaggagaagacgctgatattctaattggatgcgtaggaggt
gggagcaattttggtggttttacatatccctttatcggaaacaagaaaggcaaacgctac
attgcagtaagttctgcagaaattccaaagtttagtaaaggtgaatataagtacgatttt
ccagactctgctggattattacctttagtgaaaatgataactttaggtaaagattacgtt
cctccgccaatatatgcaggcgggttaagatatcatggtgtagcaccaacattaagtttg
ttagcaaaggagggtattgtggaatggagagaatataatgaaagggagattttcgacgcc
gctaagatatttatggagaatcaaggtattgtaccagctccagaatcagcccatgcaata
aaggcagtggtcgatgaagctatagaagctaggaagaataatgagcgaaaagtcatcgtc
tttaatctaagtggacatggattgttggatctatcaaattacgaatccatgatgaaaagg
ttgaatggaaatgggtaa

DBGET integrated database retrieval system