KEGG   Sulfolobus islandicus L.D.8.5: LD85_1452Help
Entry
LD85_1452         CDS       T01158                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LD85_1452
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LD85_1452
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LD85_1452
Enzymes [BR:sii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LD85_1452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1283325..1284515
Genome map
AA seq 396 aa AA seqDB search
MKCLSCGYETEIDQDQILCPRCGGLLEIIVEPPKDFSFSKLRGRGVWRYKELIAGKYKNI
VSINEGNTPLIRSSNINDNLYFKFEGLNPTGSFKDRGMTVAVSSAVSLNYKTVIAASTGN
TAASAAAYAARAGIKSFIVLPKGKVALGKLAQSILYGSVILEVDGSFDVAMDAVMRLYKD
LKVVYPLNSFNPWRLEGQKTIAFEIAEELGVPDNVIIPVGNAGNIYAIWKGFNELVKTGV
INTIPRMIGIQAEGASPIATAIVKGKDSPDFVENPDTVATAIRIGKPVNWQKAMKAIRES
NGTAITVSDSEILDAQKTLARKEGIGAEPASAAALAGYIKAINEKVVDKDEKTVLILTGH
SLKDPDSMTKAEAKRILVNPLHMEKIILGEINGSNS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcttaagttgtggatatgaaacggaaatagatcaagatcagatattatgtcca
agatgtggaggactattggaaattatagtggaaccaccaaaggacttctctttcagcaaa
ttgagaggaagaggagtttggagatacaaagaactgatagcaggcaaatataaaaatatt
gtaagtataaatgaaggaaataccccgctaataagatcctcaaatataaatgataatctt
tattttaaattcgaaggacttaatcctactggaagttttaaggatagaggaatgacagta
gcagttagttctgcagtaagcttaaactacaaaaccgtaatagcagcatctactggaaac
actgcagcttccgcagctgcttatgctgcaagagcaggtataaagagctttatcgtctta
cctaaaggtaaggtagcattaggtaaattagctcagtcaatactttatggctcagttatt
ttagaggttgatggaagttttgacgttgctatggatgcggtaatgaggttatataaggat
ttaaaagtagtatatccattaaattcttttaacccatggagattagaaggacagaagaca
atagcatttgagatagcggaagaactaggagttccagataatgtgataatcccagtaggc
aatgcaggcaatatttacgcaatatggaagggatttaatgagctagttaaaactggagtg
ataaatactattcccagaatgattggaatccaagctgagggagcatcaccaatagctact
gcaatagtcaaaggcaaagattctccagatttcgtagaaaatccagatactgtggctact
gcaataagaataggaaaaccagtaaattggcaaaaagcgatgaaagcaataagagaatcc
aatggaaccgcaataacagtatctgattctgaaatattagacgcacagaagaccctagct
agaaaagagggcataggagctgagcctgcttcagcagctgccttagctggttacattaag
gcaataaatgaaaaggtagtagataaagatgaaaaaacagttttaatcctaacaggacat
tcattaaaagatcccgatagtatgaccaaagctgaagctaagagaatattagttaatcct
ctacatatggaaaaaattatcctaggtgagataaatggctctaatagttaa

DBGET integrated database retrieval system