KEGG   Sulfolobus islandicus L.D.8.5: LD85_1725Help
Entry
LD85_1725         CDS       T01158                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LD85_1725
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LD85_1725
Enzymes [BR:sii01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LD85_1725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1501795..1502706
Genome map
AA seq 303 aa AA seqDB search
MRLRHVVSSLDLTGDDYFRIFELADKFSNVKKLNYLSGKVVSLAFFEPSTRTAQSFHTAA
IKLGADVIGFASEESTSIAKGENLADTIRMLNNYSNCIVMRHKFDGAALFASEISDIPII
NAGDGKHEHPTQALIDLYTIYKVFGEIDGRTFGLLGDLKYARTVNSLLRALTRFKPKKVF
LISPSQLKVRREILDGLNYPVIETENPYDVIQDIDVLYVTRIQKERFVDEVEYEKVKESY
VVDLKLVNMMKKDGIILHPLPRVTEIDRKVDKTTNAKYFYQASLAVPVRMALFYEVLGER
KDD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgagattaagacacgtagtttcttccctagacctgaccggagatgactattttcgaata
ttcgaacttgcagacaagttctctaatgtgaaaaaactaaattatctatcagggaaagta
gtttcattagctttctttgagccaagtactagaactgctcaaagctttcataccgcagca
ataaaattgggtgctgatgtaataggatttgcctcagaagaatctacttcgatagctaag
ggtgaaaatctagctgataccattaggatgttgaacaattactcaaattgtattgtaatg
agacataagtttgatggagcagcgttatttgctagtgagataagtgatatacctataatc
aatgccggagatggaaagcacgagcatcccacacaagcactcatagatttatatactatt
tataaggtgtttggcgaaatagatgggagaactttcggattattaggggatctgaaatac
gcaaggaccgtaaacagtttgctaagagcattaactagattcaaaccaaagaaggtattt
ctaatttctccttctcagttaaaggtaagaagagagattttagatggattaaactatcca
gttatagaaactgaaaatccctatgacgtgatacaagatatcgacgtgttatatgtgact
cgaattcaaaaagaaagatttgttgatgaagtagaatacgagaaagttaaggagagttat
gtggttgatctcaagttagttaatatgatgaagaaagatggaattatattgcatccatta
cctagggttaccgaaatagataggaaagtcgataaaactacaaacgctaaatacttctat
caagcatcattagccgttccagttagaatggctttattttatgaggttttgggtgaaagg
aaagatgattag

DBGET integrated database retrieval system