KEGG   Sulfolobus islandicus L.D.8.5: LD85_1742Help
Entry
LD85_1742         CDS       T01158                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LD85_1742
  Amino acid metabolism
   00340 Histidine metabolism
    LD85_1742
Enzymes [BR:sii01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     LD85_1742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1512803..1513999)
Genome map
AA seq 398 aa AA seqDB search
MISYSLPNERPNDFSRVIPVVRDIIESVKARGDNALYQLTEKLDKVKINNIKVSEEELKT
QASKLDPKVKQAIDVAYEQLKAFHEMLVPPNIGGGYQGISFGVVWRSIEKIGIYVPSGKY
SYPSTLLMAGIPAKVAKVKEIYVASPPNQEGSVNPALAYVAIKLGVNDVYKVGGAQAIAA
LAYGTESVRKVYKIVGPGNVYVQAAKFLVSNVVGIDGIEGPTELVIIADETAKPEHVVLD
MKAQAEHGPDTYIVLLSNDDELLKKVEEKIMDDKKIYYIIKTKNIDEAIEIANKIAPEHL
SLYVKDAYTLMDKIVNAGAISLGNTPPAIIDYVAGPNHILPTNGWARIRGGVTVYDFIKP
TMYANVRDINKQLLEASISLANYEGFVIHGKSIGVRYE
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgatttcctatagtttaccaaatgagagacctaacgattttagcagagtgattccagta
gttagagatattattgaatctgttaaggctaggggagataacgcgttatatcagctaact
gaaaaattggataaggtgaagataaataacatcaaggtaagtgaagaagaattaaaaacg
caagcttctaagttagatcctaaagttaagcaagctatagatgtggcttatgagcaatta
aaagcatttcacgaaatgctagttcctccaaatattggagggggttatcaaggaatatca
tttggagtagtttggagaagtatagaaaagattggaatatatgttccttccggtaaatat
tcctatccatcaaccttactaatggctggaataccagcaaaagtagctaaggtaaaggaa
atttacgtagcctctcctcctaatcaagaaggatcagtaaatccggctttagcttatgtt
gcaattaagctaggagtaaatgacgtttataaggtaggtggtgcacaagcaatagctgct
ttagcttatggtactgagagtgtaaggaaagtttacaagattgtaggaccgggtaatgtt
tatgtccaagctgcgaagttcctagtgagtaacgttgtcggaattgatggaattgaagga
ccaactgaattagtaataatagcagatgagactgcaaagcctgaacatgttgtattagat
atgaaggcacaggctgaacatggccctgatacgtatatagtactcttatctaatgatgac
gaacttctaaagaaggttgaagagaaaataatggatgataaaaaaatatattacataata
aaaactaaaaatatagatgaggctatagaaattgcaaataaaattgccccagagcatcta
tccttatatgttaaagacgcatataccttaatggataaaatagtaaatgcaggagcaata
agcctaggaaacacacctccagcaataatagattatgtagctggtcctaatcatatttta
cctactaatggctgggctagaattagaggaggcgttactgtttacgattttataaagcca
acaatgtacgctaatgtccgtgatataaataaacaattacttgaagcatctatttcttta
gcaaactatgaaggattcgtaattcatggtaaaagtataggtgtccgatatgagtaa

DBGET integrated database retrieval system