KEGG   Sulfolobus islandicus L.D.8.5: LD85_1789Help
Entry
LD85_1789         CDS       T01158                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
sii00010  Glycolysis / Gluconeogenesis
sii01100  Metabolic pathways
sii01110  Biosynthesis of secondary metabolites
sii01120  Microbial metabolism in diverse environments
sii01130  Biosynthesis of antibiotics
sii01200  Carbon metabolism
sii01230  Biosynthesis of amino acids
Module
sii_M00002  Glycolysis, core module involving three-carbon compounds
sii_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LD85_1789
Enzymes [BR:sii01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     LD85_1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N NAD_binding_3 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADB87450
UniProt: D2PCN0
Position
1555714..1556736
Genome map
AA seq 340 aa AA seqDB search
MISVAVNGYGTIGKRVTDAILKQPDMRLVGVAKTSPNYEAFIAHRKGIKIYVPQQSIKKF
EEAGIPVAGTIEDLVKASDIVVDTTPNGVGAQYKPIYQQFQRNAIFQGGEKAEVADISFS
ALCNYDEALGKKYIRVVSCNTTALLRTICTINKVTKVEKVRATIVRRAADQKEVKKGPIN
SLVPDPATVPSHHAKDVNSVIKNLDIVTMAVIAPTTLMHMHFINITLKDKVEKKDVLSVL
ENTPRIVLISSKYDAEATAELVEVARDLKRERNDIPEVMVFDDSVYVKDNEVMLMYAVHQ
ESIVVPENVDAIRASTRLMSAEDSIRITNESLGILKGYLI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgattagtgtagctgttaatggatatggtactataggtaagagagttactgatgctatc
cttaaacaaccagatatgagactagtaggggttgcaaagacatctccaaattacgaagcg
tttatagcacatcgtaaggggataaagatttacgtcccacaacaatctattaagaaattc
gaagaagctggaataccagttgctggcacaatagaggacctagtaaaagcctctgatatt
gtagtagatactacgcccaatggtgttggtgcacaatataagccaatttaccaacaattc
caaagaaacgctatattccaaggtggagaaaaagcggaagttgctgatatttcgttctca
gccttatgcaattacgatgaggcccttggcaaaaagtacattagagtcgtgtcatgtaat
actacagcactactaagaacaatatgcacaataaataaggtcactaaagttgaaaaagtt
agggcaacaatagttagaagagctgcagatcaaaaggaagttaagaaaggtcctataaat
tcattagtaccagaccctgcaactgtaccaagtcatcatgcaaaagacgttaacagtgtc
attaaaaatttagatatagttacaatggcagtaatagctccaacaacgttaatgcatatg
cactttattaacataaccttaaaggataaggtagagaaaaaagatgtacttagcgttctg
gagaacactcctaggatagtcctaatctcctcaaagtatgatgcagaagctacagcagaa
ttagtagaagtagcaagagatctgaaaagggaaagaaatgatattccagaggtgatggtg
ttcgatgactctgtttatgttaaggataacgaggttatgttaatgtatgcagtgcatcaa
gaatcaatagtggtaccagaaaatgtggatgcaataagggcctccactagattaatgagt
gcagaagactcaataagaattacaaatgaaagtttaggaatattaaaggggtacctaata
tga

DBGET integrated database retrieval system