KEGG   Sulfolobus islandicus L.D.8.5: LD85_2074Help
Entry
LD85_2074         CDS       T01158                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:sii01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sii01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sii00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sii00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sii00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:sii00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1800591..1801739
Genome map
AA seq 382 aa AA seqDB search
MKTTLSVIKADIGSLAGHHVVHPDTIAAANKILAEAKRNNVISDYYITYVGDDLQLIMTH
NRGELDTKVHETAWNAFKEAAKVAKDLGLYAAGQDLLSDSFSGNLRGMGPGIAEMEFEER
PAEPVVIFMADKTEPGAYNLPLYKIFADPFNTAGLVIDPTMHEGYKFEVLDVYEGESIIL
NTPEETYDLLALIGTPSRYIVRRVYRKADNLQASVVSVERLNLIAGKYVGKDDPVMVVRA
QHGLPALGEILEAFTVPYLVPGWMRGSHYGPLMPVSQKDARATRFDGPPRLVGLGFNIKN
GKLVGPTDLFDDPAFDEVRRTAVIIADYIRKHGPFMPHRLEPQEMEYTTLPLVIEKLKNR
FKKETDMYKTKPSVYSHESSHE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactacacttagtgtgatcaaagccgatataggaagcctagctggacatcatgtt
gttcatcctgatactatagctgcagctaataagatattagcagaagctaaaaggaataac
gtaatttccgattattacataacttatgttggagacgatttacaattaataatgactcat
aatagaggagaactagatactaaagttcatgaaacagcctggaatgcctttaaagaagct
gcgaaagtagctaaggatttaggattatatgctgcagggcaagatttgctttcagattcc
ttttctggaaatcttagaggaatgggtcctggaattgctgaaatggaatttgaggagaga
cctgctgaaccagtggttatttttatggctgataagactgagcctggtgcatataatcta
ccattatataaaatatttgcagacccattcaatactgctgggctagtaatagatccaacc
atgcatgaaggatataaatttgaagttttagatgtatatgaaggagagtcaataatttta
aacacaccagaagagacttacgatctacttgcgttaataggaacccctagcagatacatt
gttagaagagtttatagaaaggccgataatttacaagcctcagttgtttctgtagaaaga
ttgaatctaatagctggcaaatacgtaggcaaagacgatccagttatggtagtaagagct
caacacggtttgcctgcgttaggagaaatcttagaagcatttacagtaccttatttggta
ccggggtggatgagaggtagtcactatggacctcttatgccagtatcacaaaaggatgcg
agagccacaaggttcgatggtcctcctaggttagtaggtttaggatttaacatcaaaaat
gggaaactagtagggcctactgatttatttgatgatcctgcatttgatgaggtaaggaga
acagctgtaataattgcagattacattaggaaacatggcccatttatgcctcatagatta
gagccacaagaaatggagtacaccacactcccattagtaatagagaagttaaagaataga
tttaagaaagagacagatatgtataaaactaaaccaagcgtatattcacacgaaagttcg
catgaataa

DBGET integrated database retrieval system