KEGG   Sulfolobus islandicus L.D.8.5: LD85_2211Help
Entry
LD85_2211         CDS       T01158                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LD85_2211
Enzymes [BR:sii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LD85_2211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1910061..1910765)
Genome map
AA seq 234 aa AA seqDB search
MRILFLRPDNEDKELNEKLMLLQKNGIEVLNIPIFKIKCIPYSLPNYDYEALAFTSRNSV
ICFKEHFLIKNRKIYAIGEETSELLMRMYNTNPITPEKFTSVELARRILEDKVNSVLSIR
SKKASEDMKNLLNGKIKYDEIYVYDSEIIGDNINKVSKILAKCEVDAIAFTSSLMARLIG
PYISRKCKIIVYSIGPITTETLKRVNNEVKIIESKTHSIKGIIETILVEMKRNG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaggatattattccttaggcccgataacgaagacaaggagctcaacgaaaagcttatg
ctccttcagaaaaatggaattgaggttctaaacatacccatttttaaaataaaatgtatc
ccgtattcattaccgaactatgattatgaggcccttgcatttacaagtagaaattcagtt
atttgttttaaagaacatttcctcattaaaaatcgtaagatatacgccataggagaagaa
acttcagagttactaatgagaatgtacaatacaaatccaataactccagagaaatttaca
agcgtagaactagctagaagaatcttggaagataaggtaaatagtgtgctcagcataagg
agtaaaaaagcttctgaagatatgaaaaatcttcttaatggcaaaattaaatatgatgag
atctatgtatatgattcggaaataattggagataatataaataaagtgtcaaaaatccta
gctaaatgtgaagtcgatgccatagcatttactagctcattgatggcaaggctaattggc
ccttatattagtagaaagtgtaagattatagtatatagcataggtccgattacgacggaa
actttgaaacgggttaataatgaggtaaaaataatagaaagtaagacacattctatcaaa
ggcattatagaaactattttggtggagatgaaacgaaatggatga

DBGET integrated database retrieval system