KEGG   Sulfolobus islandicus L.D.8.5: LD85_2214Help
Entry
LD85_2214         CDS       T01158                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LD85_2214
Enzymes [BR:sii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     LD85_2214
Exosome [BR:sii04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LD85_2214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1912877..1913887)
Genome map
AA seq 336 aa AA seqDB search
MVTFPFLRPRRLRKNKLVRDLVAETTLFQDDLVLPIFIKESINEPEQITSMPGVYRYPPN
DKLVNYVQDSYENGIRSIILFGIPSYKDEIASSAYDKNGVIQRAVKIIKDSFKDKIIVIT
DECTDEYTSHGHCGLVNYNNGCYVIDNDESLKIHAKIALSQAEAGADIIAPSSMMDGVVK
AIRDALDGAGYNDTLIMSYSVKYASIMYGPFRDAAYSKPAFGDRRGYQMDPRNAFEALKE
ARLDIEEGADILMVKPAHTYLDVIRLVKDHFPEYPLAAYHVSGEYSMIKAAAINGWIDER
TAVLEITTAIKRAGADLIITYYANDIVRWIKEGVPF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggtaacattcccatttttgagaccaagaagattaagaaaaaacaaattagtaagagat
ctagtagctgaaacgactctttttcaagacgatttagtacttccaatatttataaaggaa
agtataaatgagccagaacaaattacttcaatgccaggagtgtacagatatccaccaaat
gataagttagtcaattatgtacaagatagctatgaaaatggtattcgaagtattatattg
tttggaattccatcttataaagacgagatagcatcatcagcctacgataaaaatggtgta
atacagagggcagttaaaataataaaagatagttttaaggataagattatagtaatcaca
gacgagtgtactgatgagtatacgtctcatggtcattgcggtcttgtgaactataataac
ggatgttatgtaatagataatgatgaaagcctaaagattcatgcaaagattgcattaagc
caagctgaagctggagcagatattatagccccatcaagcatgatggacggtgttgttaag
gctataagagatgcgctagatggagctggttacaatgatacattgataatgtcatacagt
gtaaagtacgcttcaataatgtatggtccttttagggatgcagcttactctaaaccagcg
tttggagataggagagggtatcagatggatcctaggaacgcatttgaagcactaaaagaa
gctagattagatatagaggaaggagctgatattttgatggttaaacctgcccatacatat
ttagatgtaataagattagtaaaagatcacttcccagaatatcccctagcggcatatcat
gtcagtggtgaatatagcatgataaaagcagcagcaattaatggatggatagatgaaagg
actgccgtattggaaattactaccgcaataaaaagagcaggggctgatttaattattact
tattatgctaacgatattgtaagatggataaaggaaggtgtaccattttga

DBGET integrated database retrieval system