KEGG   Sulfolobus islandicus L.D.8.5: LD85_2380Help
Entry
LD85_2380         CDS       T01158                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LD85_2380
Enzymes [BR:sii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LD85_2380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2052859..2053740)
Genome map
AA seq 293 aa AA seqDB search
MIAVVGSYNVDVILRVSKIPEIGETVIADEVYITHGGKGSNQAVSASRLGSHVKIIAAVG
DDKHGTNAIEFWKSENIDVSKVKIKNGINTGTAYIFVDKKGRNIIVVNRGANYNLSEDDL
NNSLEGDILLIQLEIRENVVKKAAKEFNGIKILNPAPANLKDTEILSLVDIITPNEIEFK
ELVNTDDFEYGLNVLLKKVKKAVIVTLGERGALLATRDGKKVLIPSPKVNVIDETGAGDV
FNAALSVYLEKGFDLETAVEYANKVAALSVTKIGALGPKLDEVRKFLEEIDNE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgatagctgtagtaggaagttataacgttgatgtaatactgagagtaagtaaaataccg
gaaattggagaaacggtaatagctgatgaggtatacataactcacggagggaagggctca
aaccaagcagtatcagcttcaagattaggaagtcatgttaaaataatcgctgcagtggga
gatgataagcatggaacgaatgcaattgaattctggaaatcggaaaatattgacgtatct
aaagttaagataaagaatggtataaacactggcactgcatatatattcgttgacaagaaa
ggaagaaatatcattgtcgtaaacagaggcgctaactacaacttgtcagaagacgattta
aataatagtcttgagggcgatatattgttaatacaattggaaataagagaaaacgtagtt
aaaaaggctgcaaaggagtttaacggaataaaaatacttaatcccgcgccagcaaacctt
aaagatactgaaatcttgtcattagtagatattataacacctaatgaaatagagtttaaa
gagttagtaaatactgatgattttgagtatggcttaaatgtattactaaagaaagtaaaa
aaggcagttatagttacgttaggggaaagaggagctttattagcaactagggatggaaaa
aaggtacttataccatctcctaaagtaaacgttatagatgaaacgggagctggagatgta
tttaacgcagcactttccgtctatttggaaaagggattcgatcttgagaccgcagttgaa
tatgcaaataaggttgcagcactttccgtaactaagataggagctttaggaccaaaatta
gatgaggtgagaaaattccttgaggaaatcgataacgagtaa

DBGET integrated database retrieval system