KEGG   Sulfolobus islandicus L.D.8.5: LD85_2759Help
Entry
LD85_2759         CDS       T01158                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sii01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sii00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sii00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sii00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sii00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:sii00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2382155..2384155
Genome map
AA seq 666 aa AA seqDB search
MSVTWALPFDQKINPKLNLNRLVSITTYKEIHSQTVKDYKQFWASVASEIDWFKPWEKTL
DDSNPPFYKWFVGGELNASYLTVDRHVKSWRKNKVAIIWEGEPVDEKGNPKEVRKLTYYD
LYREVNRVAYLLKEKYGLKKGDAIAIYLPMIPELPIFMLAAARIGVVFTVVFSGFSADAL
ASRINDAEAKLLITADGGWRRGKVVDLKGIVDKALEKTPTIKDVIVVRRIGNKVNMVEGR
DKYFDEVIKDIPQNVYVEPERMKSEDPLYILYTSGTTGKPKGIVHDIGGYMTLLHATMKW
VFDIRDDDIYWCTADIGWVTGHSYIVFGPLMEGATEIMYEGALDYPQPDRWVSIIERYGI
TILYTSPTAIRSFMKYGDNWVKAHITSTVRLMHSVGEPINPEAWEWLWKLVGREEVPFGS
TWWMTETGGILISHLPGLYLVPMKAGTNGPPILGIEPDVVNEDGKQVNLEERGYLVIKNP
WPGMPLTIYKDPERYVKVYWSRFPGMFYVGDYAVKDKDGYFWILGRADEVIKVAGHRLGT
YELESALIEHPAVAEAAVIGVPDPVKGEVPYAFVILRQGYTPNTQLSQEILKTVRDKVGP
IATIDKIFFVGKLPKTRSGKIMRRVVRAVATRAEVGDITTLEDEASVEEIKKALEEFKAE
FEKINK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaacgtgggctctaccttttgatcaaaagataaacccaaaactgaatttaaat
aggctagtaagtataactacgtataaagagattcacagccaaacggtaaaagattacaaa
caattttgggcatctgtagcctcggaaattgactggttcaaaccatgggagaaaacacta
gacgatagtaatcctccattctataagtggttcgtaggtggagagcttaacgcctcttat
ctaactgtagataggcacgttaagagctggaggaagaataaggttgccataatatgggaa
ggagaaccagtggacgagaagggaaacccaaaggaggttaggaagttaacatattacgat
ctatatagggaagttaatagagtagcctatctcttgaaggagaaatacgggttaaagaaa
ggtgatgcaatagcgatttaccttccaatgataccggaattaccaatattcatgttagct
gctgctaggatcggagtagtctttacggtggtgttctcaggatttagcgctgacgcattg
gcaagtaggattaatgacgccgaagccaagttactaattaccgcagatggtggatggaga
aggggtaaagttgttgacttaaagggaattgtagataaggctttggagaagaccccaaca
ataaaggatgtaatagtagttagaaggataggtaataaggtcaacatggttgaaggtagg
gataagtactttgatgaagtaatcaaggacattccacaaaatgtttacgttgaaccagaa
aggatgaaatctgaagacccgttatatatactctacacctctggaaccactggaaaacct
aagggtatagtccacgatattggagggtatatgacattattacacgctacaatgaagtgg
gtattcgatataagggatgacgacatttactggtgtaccgcagatataggatgggttact
ggacactcttacattgtgtttggaccattaatggaaggagcaactgaaataatgtatgaa
ggagccttggattatccacaaccggataggtgggtatcgataattgaaaggtatgggatc
acaatcctttatacctcacccactgcaattagaagcttcatgaaatatggtgataattgg
gttaaggctcacattacctccactgttaggctaatgcattctgtaggtgaaccaataaat
ccggaagcttgggagtggctatggaaattagtcggtagagaggaggtaccatttggaagc
acttggtggatgactgagactggaggtattctaatatctcatttaccaggattgtatctt
gtgccaatgaaagctgggacaaatggcccaccaatattgggaattgagccagatgtagtt
aatgaagatgggaaacaagttaaccttgaggaaagaggatatcttgttataaagaatccg
tggcctggaatgccattaacaatttacaaggatcctgaaagatacgtgaaggtgtattgg
agtagattccctggaatgttctatgttggtgattacgctgttaaggacaaggatggatac
ttctggatattagggagggctgatgaagttataaaggtagctgggcataggttaggtaca
tatgagttagaatcagctttaattgagcatcctgcagttgcggaagcagcggtaattgga
gtcccagacccagttaagggagaggtgccttatgcgtttgtaattttgaggcaaggttat
acacctaatacgcagctttcacaagagatactgaagacggtaagagataaggtgggacct
atagctactatagataagatattcttcgtgggtaagttgcctaaaacgagaagtggaaag
ataatgagaagagttgtaagggctgttgcaactagggcagaagtgggagatataactaca
ctggaggatgaggcttctgtagaggagattaaaaaagctttagaggagtttaaggcagag
tttgaaaagattaacaaataa

DBGET integrated database retrieval system