KEGG   Sulfolobus islandicus L.D.8.5: LD85_2877Help
Entry
LD85_2877         CDS       T01158                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
sii00010  Glycolysis / Gluconeogenesis
sii00020  Citrate cycle (TCA cycle)
sii00620  Pyruvate metabolism
sii00640  Propanoate metabolism
sii00650  Butanoate metabolism
sii00680  Methane metabolism
sii00720  Carbon fixation pathways in prokaryotes
sii01100  Metabolic pathways
sii01120  Microbial metabolism in diverse environments
sii01130  Biosynthesis of antibiotics
sii01200  Carbon metabolism
Module
sii_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LD85_2877
   00020 Citrate cycle (TCA cycle)
    LD85_2877
   00620 Pyruvate metabolism
    LD85_2877
   00640 Propanoate metabolism
    LD85_2877
   00650 Butanoate metabolism
    LD85_2877
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LD85_2877
   00680 Methane metabolism
    LD85_2877
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LD85_2877
Enzymes [BR:sii01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     LD85_2877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_10 Fer4_7 Fer4_2 Fer4_16 Fer4_9 Fer4_4 Fer4_13 Fer4_17 Fer4_15 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADB88476
UniProt: D2PHB1
Position
2492341..2492625
Genome map
AA seq 94 aa AA seqDB search
MNKLVLSMSLLEYQYFPVTRPNKGAGGRTGAWRIVKPVVDYNKCIGCKVCFMFCPESTIV
PSNDKVRVDYEYCKGCGVCANVCPVKAISMVNEQ
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagttggtgttgagtatgtcactgcttgaatatcaatactttcctgtaactaga
cccaataagggtgctggaggaagaactggagcatggagaatagtaaaacctgttgttgat
tataacaagtgcataggctgtaaagtgtgttttatgttttgcccagaatccacaatagtc
cctagcaatgataaggtaagagtggattatgagtattgcaaaggctgtggagtttgtgcc
aatgtatgcccagttaaggctataagtatggtgaatgagcaatga

DBGET integrated database retrieval system