KEGG   Sulfolobus islandicus L.D.8.5: LD85_2878Help
Entry
LD85_2878         CDS       T01158                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LD85_2878
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LD85_2878
   00020 Citrate cycle (TCA cycle)
    LD85_2878
   00620 Pyruvate metabolism
    LD85_2878
   00640 Propanoate metabolism
    LD85_2878
   00650 Butanoate metabolism
    LD85_2878
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LD85_2878
   00680 Methane metabolism
    LD85_2878
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LD85_2878
Enzymes [BR:sii01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     LD85_2878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2492622..2493824
Genome map
AA seq 400 aa AA seqDB search
MIRKIISGNEAVALGVKLARVGVTGIYPITPQTTIIEKLAEMRAKGEIETEIVRVESEHS
AMAATFGAALGGVRAFTATASQGLLYMHEMIWWVAGSRVPVVMVVGTRAVGAPWNIWNEH
TDFTSERDSGWIMAFASNPQEALDLTLQAFRISEDERVFLPMMVGMDGFILSHTKTNVLI
PDQDQVDEFLPPRRQPYVIDPEDPIGMGNIFPPEGYMRLRESIDLALRNSENIIKEIGRE
YNKKINPLGDYSTLNVSYKLEDADYAIVLMGAWAGDAMEAVDTLREKGIKIGMLRIRYLR
PWSEKEIRNALKDKRAVLVLDRSTSFGRGGGPLYVEVKSTISDIVPQVKGVVSGLGGVTV
NKSELLYIFNKFVEGLKDDVIWYYPKEVGKIEFRTPRDIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgattagaaagattatttctggaaatgaagctgttgcgttaggtgtgaaactagcgaga
gtaggagttacaggaatatacccaataacgccacaaactacgataattgagaaattagct
gagatgagagctaaaggtgaaattgaaaccgaaatagtgagagttgaaagtgagcactcg
gcaatggctgcaacgttcggtgctgctttaggtggtgttagggcttttactgctaccgca
tcgcaaggcctgctttacatgcacgaaatgatttggtgggtggctgggagtagagtacca
gtagtaatggttgtaggtactagagcagtaggagctccttggaacatttggaatgagcat
accgactttacaagtgagagggatagtggatggataatggcttttgcatccaatccgcaa
gaagcattagatctaactttacaagcgtttaggatttcagaggatgagagagtattctta
ccaatgatggtcggtatggatggattcatcctttcgcatactaagactaatgtactaata
cccgatcaagatcaagtagacgaattcttacctccaaggagacagccatatgtgatagat
ccagaggacccaataggtatgggtaacatattccctccggagggctatatgagactaagg
gaatcaatagatttagcacttagaaattcagagaatataataaaagaaataggaagagaa
tataataagaaaattaatccactaggagattactccacactaaatgtgtcgtataaacta
gaagatgcggattacgcaatagttttaatgggagcttgggcaggagatgccatggaggct
gtagatacattaagggagaaggggataaaaataggcatgttaagaataaggtatcttaga
ccttggagtgagaaggagataagaaatgcgttgaaggataaaagggctgttctagtgtta
gatagaagtacgagttttggtaggggtggaggaccactttacgttgaagtaaagtccaca
atatcggacattgtaccacaagtaaaaggtgtagtgagtgggttgggaggtgttacagtt
aacaagagcgagctattgtatatatttaacaagtttgtagaaggcttaaaggatgacgta
atttggtattatccaaaggaggtggggaagattgagtttaggactccgagagatattgaa
taa

DBGET integrated database retrieval system