KEGG   Sulfolobus islandicus L.D.8.5: LD85_2879Help
Entry
LD85_2879         CDS       T01158                                 

Definition
(GenBank) thiamine pyrophosphate enzyme domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
sii00010  Glycolysis / Gluconeogenesis
sii00020  Citrate cycle (TCA cycle)
sii00620  Pyruvate metabolism
sii00640  Propanoate metabolism
sii00650  Butanoate metabolism
sii00680  Methane metabolism
sii00720  Carbon fixation pathways in prokaryotes
sii01100  Metabolic pathways
sii01120  Microbial metabolism in diverse environments
sii01130  Biosynthesis of antibiotics
sii01200  Carbon metabolism
Module
sii_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LD85_2879
   00020 Citrate cycle (TCA cycle)
    LD85_2879
   00620 Pyruvate metabolism
    LD85_2879
   00640 Propanoate metabolism
    LD85_2879
   00650 Butanoate metabolism
    LD85_2879
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LD85_2879
   00680 Methane metabolism
    LD85_2879
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LD85_2879
Enzymes [BR:sii01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     LD85_2879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C E1_dh Peptidase_M24_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ADB88478
UniProt: D2PHB3
Position
2493793..2494692
Genome map
AA seq 299 aa AA seqDB search
MSLGLREILNKHNGILSGTSACPGCPENMAMRMLGMGLGKDMVLVVVAGCSSVIQGNAPY
NAYNFPTVNVAFAAGPATAAGLARAYKQRGKNVTVVVWAGDGGSADIGFASLSGAAERND
NILYLTVDNEAYMNSGGQRSGSTPFGAITTTTPEGKKENKKNLPLLMIAHNVPYVATASV
GYPHDYIEKLNKAKQVEGFKYIHVLTPDPYGWLFDPSKTAEVAKLAVQTCYWPLFEYYNG
KLSISSESLHCLDRRTRRPIRDFLSVQGRFKRLTEDQIKILEQYIDNVWEKLKSMLDNQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ttgagtttaggactccgagagatattgaataagcataatggtatcttatccgggacttca
gcttgtcccggctgcccagagaatatggcaatgagaatgctaggaatgggactaggtaaa
gatatggttctagtagtagttgcgggatgttcctcagtaatacaaggaaatgcgccttat
aatgcttacaacttccctactgtgaacgttgcctttgcggctggtccagctacggctgct
ggtttggctagagcgtataaacaaagaggtaagaatgtcactgtagtggtttgggctgga
gatggaggaagtgctgatataggatttgcatcattaagcggagctgctgagagaaatgat
aatatactctaccttactgtggataacgaggcctatatgaatagtggagggcagagaagt
ggctcaactccctttggagcaattactactactactccagagggaaaaaaggaaaataag
aaaaacttgccattattaatgatagcgcataacgtaccttatgtggctactgcatctgta
ggatatccacatgattatatagagaagttaaataaagccaagcaagtcgaaggtttcaaa
tatattcacgtcctaactcctgatccttacggttggttatttgatccttcaaaaactgct
gaagtggcaaaattggcagtacagacttgctattggcccctctttgaatactataatgga
aaattaagcattagttcagaaagtttacattgtcttgacagaagaactagaagacctata
agagactttctgagtgttcaaggaagattcaagagattgacagaggatcaaataaagatt
ttagagcaatatatagataacgtgtgggagaagttaaaatccatgctcgataatcagtaa

DBGET integrated database retrieval system