KEGG   Sulfolobus islandicus L.D.8.5: LD85_2903Help
Entry
LD85_2903         CDS       T01158                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LD85_2903
Enzymes [BR:sii01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     LD85_2903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2516595..2517512
Genome map
AA seq 305 aa AA seqDB search
MRQIDALKSPRFTQISTFGRLPICGRDEEIKAAFLGIPFDDAVTYRPGARFGPMGIRQGS
RLLRPYNQFLDTYPFDKLNACDMGDINIIPGYIEDTMNIIQTNLYEIISSKNLVPFIAGG
DHSITLPVLRALHKKYGKINIIHLDSHYDFWDSYWGKKHTHGTWLRRAIEEGLIKEAIQG
GIRASTFSKEDLKDKERLGVKSFTIRDLKYNLDSVIREINSLSGPTHVSIDIDVVDPAFA
PGTGTPEVGGLTSFEIIEIIRKLRFDKLVGFDVVEVAPPYDVSEITTMLAANIIYEGMSV
LSLNL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaatagacgcgttaaaatctccacgcttcacacaaatttctaccttcggtaga
ttaccaatttgcggaagagatgaggaaataaaggcggcgtttttaggaatacctttcgat
gatgctgtaacttatagaccgggagccagatttggaccaatgggaataagacaaggatct
agattattaagaccttacaatcaattcctagatacttatccttttgataagcttaacgct
tgtgatatgggtgatataaacattattccggggtacattgaggatacaatgaacataata
caaacgaatctttatgaaataatatcatcaaaaaacctagtgccctttatagctggtgga
gatcactcaatcacgttacccgttttaagggctttacataagaagtatggaaaaataaat
atcatacacttggattcacattacgacttctgggattcctattggggtaagaaacatacg
catggtacgtggttgaggagggcaattgaagagggcttaatcaaagaagctatacaagga
ggaattagggcctcaacgttctcgaaagaagatcttaaagataaggagagattaggagtg
aagagtttcacaattagagatttaaagtataatttagattctgttataagggaaataaat
tccctatctggtcccacacacgtttccattgatatagatgttgtagatccggcgtttgcc
cctgggactggtacgccagaagtgggtggtttgacaagcttcgaaattatagaaattatc
agaaagctgagatttgataaactagttggatttgatgttgtagaagttgccccaccatat
gatgtaagcgaaatcaccacaatgttagctgcgaatatcatctatgaaggaatgagcgta
ctctcactaaatctttaa

DBGET integrated database retrieval system