KEGG   Sulfolobus islandicus L.D.8.5: LD85_3038Help
Entry
LD85_3038         CDS       T01158                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sii  Sulfolobus islandicus L.D.8.5
Brite
Enzymes [BR:sii01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     LD85_3038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2641820..2642482)
Genome map
AA seq 220 aa AA seqDB search
MGAKEDLLRSIKNSKVANAFIKVNREDFLPQLLKKYAYDPNYIDKPFYVTPNITTTALSL
GIYILDILNLEENQKVLEIGTGIGYYTALIAEVVGENNIVSIEIDDTMFEYAKNVLLIRY
PLIKLLKTDGSLGYEKEAPYDRIVVWAAAPTIPCKLYDQLKENGIMVVPIGGEKAQGLYR
ITKTGYEPKIERIGDVIFMKMRGLFGFYDNDDPNERRIKN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcaaaagaagacttattaagatctataaaaaattcaaaggtggctaatgcattt
atcaaagttaatagagaagactttttgccgcaactattgaaaaaatacgcatatgaccca
aattatatagataaacccttttatgtaacacctaacattacgacaacggcgctaagttta
ggcatatatattcttgatattcttaatttagaagaaaatcagaaggttttagagataggt
actggtataggttattacacagcactgatagctgaagtagttggtgagaataacattgta
tctatcgaaatcgatgatacgatgtttgagtacgctaaaaatgttcttctgatcagatac
cccctaattaaattactgaagacggatggaagtttaggatatgagaaagaggccccttat
gatcggatcgtagtatgggcagctgcaccaactataccttgtaagctatacgatcaactt
aaggaaaacgggatcatggtagtaccaataggaggtgaaaaagcccaaggtctttataga
attactaaaactggttatgagcctaagatagaaagaattggggatgtgatatttatgaaa
atgagaggattatttggattttatgataatgacgatccaaacgagaggagaataaaaaat
tag

DBGET integrated database retrieval system