KEGG   Sulfolobus islandicus L.D.8.5: LD85_3044Help
Entry
LD85_3044         CDS       T01158                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
sii00010  Glycolysis / Gluconeogenesis
sii00051  Fructose and mannose metabolism
sii00562  Inositol phosphate metabolism
sii01100  Metabolic pathways
sii01110  Biosynthesis of secondary metabolites
sii01120  Microbial metabolism in diverse environments
sii01130  Biosynthesis of antibiotics
sii01200  Carbon metabolism
sii01230  Biosynthesis of amino acids
Module
sii_M00002  Glycolysis, core module involving three-carbon compounds
sii_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LD85_3044
   00051 Fructose and mannose metabolism
    LD85_3044
   00562 Inositol phosphate metabolism
    LD85_3044
Enzymes [BR:sii01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LD85_3044
Exosome [BR:sii04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LD85_3044
  Exosomal proteins of bladder cancer cells
   LD85_3044
  Exosomal proteins of melanoma cells
   LD85_3044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM NMO ThiG FMN_dh His_biosynth DUF561 G3P_antiterm IGPS DHO_dh Glu_synthase IMPDH Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ADB88637
UniProt: D2PII1
Position
complement(2646450..2647133)
Genome map
AA seq 227 aa AA seqDB search
MKPPIIVINFKAYENSFGNKAIELGKKIEKISKEHSVEIILSVPATMIYRMVQEVDLPIY
AEHVDPVPLGAYTGAVLPEMIKDADAKGTLINHSERRLRADEIDDVLKRTRKLGLSSILC
VDRYELVYPFSLLRPDAILIEPPELIGTGISVSKAKPEVITKAVDEIRKSEGIYLIAGAG
ITTGEDVYKALKLGAHGIGVASAVMKAKEPEKVVEDFITSALKAISS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccccctattattgtaataaactttaaggcctacgaaaactcctttggtaataag
gcaattgagttaggtaaaaagatagaaaaaataagtaaggagcattcagttgaaataata
ttgtcagtaccagctactatgatctacagaatggtccaagaggtagatttaccaatttat
gctgaacatgtagatccagttcctctaggcgcttatacgggagccgtattaccagaaatg
ataaaagatgcagatgctaaagggacattgataaatcacagtgagagacgtctaagggct
gatgaaatagatgatgtattaaaaagaactaggaaattaggtttgagtagtatactatgc
gttgacagatatgagttagtctatccctttagtttactaaggcctgatgcaattttgata
gagcctccagaattgataggaaccggtatctcagtgtctaaagccaaacctgaggtaata
acaaaagccgtggatgagataagaaagtctgaggggatctatttaatagcgggtgctgga
attacaaccggtgaggacgtttataaagcgttaaagctcggagctcatggaataggtgta
gcaagtgcagtcatgaaggctaaagaacctgagaaagttgttgaagattttatcacaagt
gcattgaaggctatctcttcttag

DBGET integrated database retrieval system