KEGG   Streptococcus iniae: K710_0073Help
Entry
K710_0073         CDS       T02686                                 

Definition
aldehyde-alcohol dehydrogenase 2
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sik  Streptococcus iniae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sik00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    K710_0073
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    K710_0073
   00620 Pyruvate metabolism
    K710_0073
   00650 Butanoate metabolism
    K710_0073
  Lipid metabolism
   00071 Fatty acid degradation
    K710_0073
  Amino acid metabolism
   00350 Tyrosine metabolism
    K710_0073
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    K710_0073
   00626 Naphthalene degradation
    K710_0073
Enzymes [BR:sik01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     K710_0073
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     K710_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
56031..58679
Genome map
AA seq 882 aa AA seqDB search
MADKKLSPEQKLQEAQAHVDELVQKGLVALDEFRQLNQEQVDYIVAKASVAALDAHGILA
MHAHEETGRGVFEDKATKNLFACEHVVNNMRGVKTVGVIEDDPMTGLTKIAEPVGVICGV
TPTTNPTSTAIFKALIALKTRNPIVFGFHPSAQESSAHAAQIVRDAAIAAGAPENCIQWI
SKPSMEATGALMNHDGIATILATGGNAMVRAAYSCGKPALGVGAGNVPAYVEKSADIRQA
AHDIVMSKSFDNGMVCASEQAVIIDKEIYKAFVEEFKSYKTYFVNKKEKALLEEFCFGVK
ANSKDCSGAKLNADIVGKPAAWIAEQAGFKVPEGTNILAAECAEVGENEPLTREKLSPVI
AVLQADSTEDGLKKARQMVEFNGLGHSAAIHTKDEELAKRFGTEMKAMRIIWNSPSTFGG
IGDVYNAFIPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGKRRNNMQWFKVPSKIYFERN
SIQYLQTCEDMERVMIVTDKSIEKLGFVQRVIDQLNLRHNKVAIQIFSDVEPDPDITTVQ
RGAEVMRAFEPDTIIALGGGSPMDAAKIMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPAL
GEKAKYIGIPTTSGTGSEVTPFAVVSDKANNRKYPLADYSLTPTLAIVDPALVESVPGFI
AADTGMDVLTHATEAYTSNFANDYTDGLALQAIKLVFEYLTKSVKENDVEAREKMHNAST
MAGMAFANAFLGMSHSMAHKIGGVHHTVHGRTNAILLPYVIRYNGTRPSKTTTWPKYNYW
KADEKFQDIARMLGLPASTPEEAVASYAKAVYDLGVAVGIKMNFKDQGIDEKVWMDSLHD
IALLAYEDQCSPANPRLPMVADMEEIMADAYYGYADRPGRLK
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaaaaaactttcaccagaacaaaaattacaagaagctcaagcacatgttgat
gaacttgttcaaaaaggtttggttgctttagatgaatttcgtcaattaaatcaagagcaa
gtagactacatcgttgctaaagcatctgtagctgccttagatgctcatggtatcttagct
atgcatgcgcacgaagaaacaggacgcggtgtttttgaagataaagctacaaaaaacctg
tttgcttgtgagcatgttgttaataatatgcgtggtgttaaaactgttggtgttattgaa
gatgatccaatgactggattaacaaaaattgctgagcctgtaggtgttatttgtggggtt
acaccaacaacgaacccaacgtcaacagcaatctttaaagctttgattgctttgaaaaca
cgtaacccaatcgtatttggtttccatccatcagcacaagagtcttcagcacatgcagca
caaatcgttcgtgatgcagcaattgcagctggtgctcctgaaaactgtattcaatggatt
tcaaaaccatcaatggaagctactggtgcattgatgaatcatgatggtattgcaactatc
cttgcaactggtggtaatgcaatggttcgcgcagcctattcatgtgggaaaccagcactt
ggtgtaggtgcaggtaacgttcctgcttatgttgaaaaatcagcagatatccgtcaagcg
gctcatgatatcgttatgtctaaatcatttgataatggtatggtctgtgcctcagagcaa
gcagttattattgataaagaaatttacaaagcttttgttgaagaattcaaatcttataaa
acttactttgttaacaaaaaagaaaaagcacttcttgaagaattctgttttggtgtaaaa
gctaacagcaaagactgttcaggtgctaaattaaatgcagatatcgttggtaaaccagca
gcttggattgcagaacaagcaggattcaaagttccagaaggtactaacatcttggctgca
gaatgtgctgaagttggtgaaaatgaaccattaacacgtgaaaaactttctccagttatt
gcagtattgcaagcagattcaactgaagatggtcttaaaaaagcacgtcaaatggttgaa
ttcaatggtcttggtcactcagctgctatccatactaaagatgaagagcttgcaaaacgt
ttcggtactgaaatgaaagcaatgcgtattatctggaattctccatctactttcggtgga
attggtgatgtttacaatgccttcattccatcattaacacttggatgtggatcatatgga
cgcaactcagttggtgataacgttagtgctatcaaccttctcaacatcaagaaagtaggg
aaacgtagaaataatatgcaatggtttaaagttccttcaaaaatctacttcgaacgtaat
tcaatccaataccttcaaacttgtgaagatatggaacgtgttatgatcgttactgataaa
tcaatcgaaaaacttggctttgttcaacgtgtcattgatcaattaaacctacgtcataac
aaagttgctattcaaatcttctcagatgttgaaccagatccagatatcacaactgttcaa
cgtggtgctgaagtgatgcgtgcttttgaaccagacactattattgctcttggtggtggt
tcaccaatggatgctgctaaaattatgtggctcttctacgaacaaccagaagttgacttc
cgtgaccttgttcaaaaattcatggatatccgtaaacgtgctttcaaattcccagctctt
ggtgaaaaagcaaaatacattggtattccaacaacttcaggtacaggttcagaagtaaca
ccgtttgccgttgtttctgataaagcaaacaaccgtaaatacccacttgctgactactca
ttgacaccaacacttgcaattgttgaccctgctttggttgaatcagttcctggtttcatc
gcagctgatacaggtatggatgtcttgactcacgcaactgaagcttatacttcaaacttt
gctaacgactacactgatgggcttgctcttcaagcaatcaaacttgtttttgaatattta
acaaaatctgttaaagaaaatgatgttgaagctcgtgagaaaatgcataacgcatcaaca
atggctggtatggcatttgccaatgcattcttaggaatgagtcactcaatggcacacaaa
attggtggtgttcaccatactgttcatgggcgtacaaatgctatcttgttaccatatgtt
atccgttacaacggaactcgtccttcaaaaacaacaacatggccaaaatacaactactgg
aaagctgatgaaaaattccaagacatcgctcgcatgttagggttgccagcatcaactcca
gaagaagctgtagcatcctatgcgaaagctgtttatgaccttggtgtagcggtaggcatt
aaaatgaactttaaagatcaaggaattgatgaaaaagtttggatggatagccttcacgat
attgctcttcttgcttatgaagaccaatgttcaccagctaacccacgtttaccaatggtt
gctgatatggaagaaatcatggctgatgcatactatggttatgctgaccgtccaggacgc
cttaaataa

DBGET integrated database retrieval system