KEGG   Streptococcus iniae: K710_0547Help
Entry
K710_0547         CDS       T02686                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sik  Streptococcus iniae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sik00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    K710_0547
Enzymes [BR:sik01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     K710_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
518339..519250
Genome map
AA seq 303 aa AA seqDB search
MSNIVVVGSISMDLVMETSRIALEGETVFGDAFSMVPGGKGANQAVALGRLSHGDDCVSM
IGTVGNDSFGPILVDNLKKNAVNVDCVGTVPESSGIAQITLFNQDNRIIVFPGANALVDT
GGWTKEWEIIKTCDLVILQNEIPHEVNLQIASYCHDHKIRVLYNPAPARSSDLEMIDYVT
YFTPNEGECKELFPDKTIEEALKSFPNKLIVTLGSKGSTYYDGKQIQMIPAIKTQAVDTT
GAGDTFNGAFGFALSNDLAIADALRFATLASHLSVQKFGAQGGMPTLDEMKGHEAYEEKW
NLK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatattgttgttgttggaagtatttccatggatttagtcatggaaactagtcgt
attgcccttgagggggagaccgtttttggggatgccttctcaatggtgccaggcggaaaa
ggggctaatcaagctgtagctcttggacgtttaagtcatggagatgactgtgttagtatg
ataggtacagttggaaatgattcttttggtccaattctagtagacaatcttaaaaagaat
gcagttaatgtggattgtgtgggaacggtaccagaatcatctggaattgcacaaattact
ctctttaatcaagataatcgcatcattgtttttccaggggcaaatgccttggttgacact
ggcggctggactaaggaatgggaaatcatcaagacctgtgatttagtgattttacaaaat
gaaattccacatgaagtcaatttacaaattgcatcttattgccatgaccataagattaga
gtgctttataatccggcaccagcacgatcaagtgatcttgagatgattgattatgttact
tacttcactccaaatgaaggtgagtgtaaggaactcttccctgataagactatagaagag
gccttgaaaagcttcccaaataagttaattgttacacttggaagtaagggctctacttat
tatgatggcaagcaaattcaaatgattccagccattaaaacacaggccgttgatacaaca
ggagccggagatacatttaacggagcttttggctttgcgctttcaaatgatttggcaatt
gctgacgctttaagatttgcaaccttagcatcacatttatcggttcagaaatttggagcg
caaggtggtatgccaacgttagatgagatgaaaggacatgaagcatatgaagaaaaatgg
aatcttaaatag

DBGET integrated database retrieval system