KEGG   Streptococcus iniae: K710_0745Help
Entry
K710_0745         CDS       T02686                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sik  Streptococcus iniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sik00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    K710_0745
Enzymes [BR:sik01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     K710_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
726663..728171
Genome map
AA seq 502 aa AA seqDB search
MTKRASGILMHISSLPGKFGIGTFGEAAYNFIDFLKESKQTYWQILPLTTTSFGDSPYQS
FSAIAGNTHFIDFDLLVKEGYLVESDFATCDFGSNPESVDYALIFNARRPILEKAVANFL
KSSDGKDKLAAFEKEASWVSDFAEFMAIKEYFDNKALQEWDDKAIIKRDQASLVAYREKL
QSVISYHKVCQYFFYQQWLALKAYANENNISIIGDMPIYVSADSVEVWTMPELFKVDEEL
KPQYIAGVPADGFSEDGQLWGNPIYKWENHQASDFDWWVFRIQESCKIYDKVRIDHFKGF
SDFWEIPGGDKTARNGRWASAPGFELFETVREKLGDLPIIAENLGYIDEKAEQLLAATGF
PGMKILEFGLYDVTSQSIDLPHNFDTNSIVYCGTHDNEVVNGWYENLTVQQARFVDKYLH
RAEGERITEAMLRTIFASVGNIAILCMQDLLDKDADSRMNMPNTVGGNWQWRMLADDLTE
ADKDYLIGLTELYGRANTSLKN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaacgcgcaagtggtattttgatgcacatcagttcattaccgggcaaatttggt
attggaacttttggagaagcagcatacaatttcattgattttttaaaagaaagtaagcag
acttattggcagattttaccactaacaacaacaagttttggtgattctccctaccaatca
ttttcagctattgcagggaatactcattttattgattttgatttacttgtcaaagagggt
taccttgttgagagtgattttgcaacttgtgattttggatcaaatccagaatccgttgat
tatgctttgatttttaatgccagacgccctattttagaaaaagctgttgctaatttttta
aagagtagcgatggtaaagacaagcttgctgcttttgaaaaagaagcttcatgggtttct
gattttgcagaatttatggctatcaaagagtattttgacaataaagctttgcaagaatgg
gatgataaagcaattatcaaacgtgatcaagcttcccttgtagcttaccgagaaaaattg
cagtctgttatttcttaccataaagtttgccaatatttcttttatcaacaatggttagct
ctaaaagcttatgctaatgaaaataatatttctattattggggacatgccaatctatgta
tcagctgatagtgttgaagtatggacaatgcctgaactgttcaaagttgatgaagaattg
aaacctcaatacattgcgggtgttcctgcagatgggtttagtgaggatggtcaactttgg
ggcaatcccatttacaagtgggaaaatcatcaagcatctgattttgactggtgggtattc
cgtattcaagagagttgcaaaatatatgacaaagtccgtatcgatcattttaaaggcttc
tctgatttttgggaaattcctggcggtgataaaacagctagaaatggccgttgggcgtca
gcacctggctttgaactctttgaaacagttcgtgaaaaattaggtgatttgccaattatt
gctgagaacctcgggtatattgatgaaaaagcagagcagttactggctgccacaggcttt
cctggaatgaaaattttagaattcggcctatatgatgtgactagtcaaagcattgacttg
ccacataactttgatacaaatagcatcgtttattgtggtacacatgataacgaagttgtt
aatggttggtatgaaaacttgactgttcaacaggcacgttttgttgataagtatttgcat
cgtgctgaaggtgaacgcattacagaagcgatgttaagaactatttttgcctctgttggg
aatattgcaatcctatgcatgcaagatttactggataaggatgcagatagccgtatgaac
atgcctaatactgttggtggaaactggcaatggcgtatgttagcggatgatttaacagaa
gctgacaaagattatttaattggcttgacagaactctacggtcgagcaaatacaagtctg
aagaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system