KEGG   Streptococcus iniae SF1: K710_1078Help
Entry
K710_1078         CDS       T02686                                 

Definition
hypothetical protein
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sik  Streptococcus iniae SF1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sik00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    K710_1078
Enzymes [BR:sik01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     K710_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1040405..1040983)
Genome map
AA seq 192 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGLVSSRIGMKREAT
PITDDMDIFSYISQLSEKPYCILIDECQFLSKENVYDLARVVDHLNVPVMAFGLKNDFQN
ELFEGSKYLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYQGQQIQIGGNETYIPVC
RKHYFDPLIDKD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaattatactataagtatgggacaatgaattcagggaaaacaattgaaatcttg
aaagttgcacacaattatgaagaacaaggaaaacctgttgtgattatgacaagtgcactt
gacacaagagatggctttgggttagtctccagtcgtattggtatgaaacgagaagcaaca
ccgattactgatgatatggatattttttcttatatcagccaactttcagaaaaaccttac
tgtattttaattgatgaatgtcaatttttaagcaaggaaaacgtctatgacctggcccgt
gttgtggaccatttaaatgttccagtcatggcctttggtttaaaaaatgatttccaaaat
gaattgtttgaaggctccaaatatttgctcttgttagcagataaaatcgatgagattaag
actatttgtcaatattgtagtaaaaaagcaactatggtcttaagaacagagaacggtaag
cctgtctatcagggccaacaaattcaaattggtggcaacgaaacctatattccagtttgc
cgaaagcattattttgacccactaattgacaaagactaa

DBGET integrated database retrieval system