KEGG   Streptococcus iniae: K710_1273Help
Entry
K710_1273         CDS       T02686                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sik  Streptococcus iniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sik00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1227225..1229102)
Genome map
AA seq 625 aa AA seqDB search
MLKDEELKAFENGDNAYIQDYFGVHRINKNNSFCYVFRVWAPNAESVSLIGDFTDWFQMP
LEMTKIAGGVWEIETDLAREGHIYKYLVTRQGGQVVEKIDPVAHVFEKRPATGAVIKTDL
DKKWHDALWMGRRKRLGFKNRPVNIYEVHANSWKKDSNGRPFQFKELKETLIPYLIKMNY
THVEFMPLMAHPLDMSWGYQVMGYFAFEATFGSQEDFQEFVDACHLHNIGVIVDWVPGHF
IQNDDALAYFDGTPTYEYEDYHRAHNYGWGAMNFDLGKGQVQSFLISSSLYWIETFHIDG
IRVDAVSNMLYLDYDQGPWTPNQKGGNHNLEGIAFLQKLTKSLKEKKPDVMLIAEEATSD
IAITKSISEGGLGFDYKWNMGWMNDVLRFYEEDPYYRKYHYDLITFSFIYCFNENYLLPF
SHDEVVHGKKSLMHKMWGDRYNQFAGLRNLYTYQMCHPGKKLIFMGSEFGQFLEWKYNDQ
LVWDNLNDSMNAKMHAFTSHLNQFYKNFNMLWQNDYSYDGLEIIDADNKDETVLSFCRKN
DKGDLLLCVFNMTPVERKNFTIGVPVAGLYEEVLNTEMEAFGGVWKDHNPNTQTQHQEWR
NYKNTLAFTLPALGASVWRMKRRKK
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagacgaagagttaaaagcttttgaaaatggtgataatgcttatattcaagat
tattttggtgttcatcgcattaataagaacaatagtttttgctatgtctttagggtttgg
gctccaaatgctgagtcggtttcactgattggtgattttacagactggtttcaaatgcct
ttggaaatgacaaaaattgctggtggtgtttgggaaatagagacagatttggcaagggaa
ggtcatatctacaagtaccttgttacaaggcagggtgggcaggtggttgagaaaattgat
cccgttgcacatgtttttgaaaagcgaccagcaactggcgcagttatcaaaactgatttg
gacaaaaaatggcatgatgctctttggatggggcgtcgaaaacgactaggttttaaaaat
cgtcctgtaaacatttatgaagtccatgccaattcctggaaaaaagatagcaatggccgc
cctttccaatttaaagaactaaaagaaactttgattccttatttgattaaaatgaactac
acgcatgttgagtttatgcccttgatggctcatcctttggatatgagctggggctaccaa
gtcatgggatactttgcctttgaagcaacatttggtagtcaagaagattttcaggagttt
gttgatgcttgtcatttacataatattggtgttattgttgactgggtaccaggacatttt
attcaaaatgatgatgcccttgcctattttgacgggactccaacttatgagtacgaagac
tatcatagggctcataattacggatggggagcgatgaactttgatttaggaaaaggtcaa
gttcaatcttttcttatttcaagttcactttattggattgaaacctttcatattgatggc
attagagtagatgctgttagtaacatgctctatttagactatgatcaagggccgtggacg
cctaatcaaaagggtggtaatcataatttggaaggcatagcctttcttcaaaaactaacc
aaaagcctcaaagaaaagaaacccgatgtgatgctcattgccgaagaggcgacttcagat
attgcaattacaaaaagcattagtgagggtgggcttggatttgattacaagtggaacatg
ggctggatgaatgatgtgcttagattctatgaagaagacccttattatcgtaaataccat
tatgatctgatcacctttagttttatctactgttttaatgaaaattacctcttaccattt
tcgcatgatgaagttgtccatggtaaaaaaagcttgatgcataaaatgtggggagaccgt
tacaatcagtttgctggtctaagaaatttgtatacctatcaaatgtgtcatccaggaaaa
aaactgatttttatggggtcagaatttggtcaatttttggaatggaaatacaatgaccaa
ttggtttgggataatttgaacgacagcatgaatgctaaaatgcatgcgttcacatcacac
ttaaatcaattttacaaaaactttaatatgctttggcaaaatgattatagttatgatggc
cttgaaattatagatgctgataataaggatgaaacagtgttatcattttgccgcaaaaat
gataaaggagatttgctcctttgcgttttcaatatgacgcctgtcgaacgaaaaaacttt
actattggtgttccagtagcaggattatatgaagaggttttaaatactgaaatggaagcg
tttggaggggtatggaaagaccataacccaaacacacaaacacagcatcaagaatggagg
aattataagaataccttagctttcactctgcctgctttaggagcaagtgtttggagaatg
aaacgccgcaaaaaataa

DBGET integrated database retrieval system