KEGG   Streptococcus iniae SF1: K710_1346Help
Entry
K710_1346         CDS       T02686                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sik  Streptococcus iniae SF1
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sik00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    K710_1346
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    K710_1346
  Energy metabolism
   00680 Methane metabolism
    K710_1346
Enzymes [BR:sik01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     K710_1346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1306418..1307506)
Genome map
AA seq 362 aa AA seqDB search
MTVNKLESRNNTEIIAEEVAILKEMLEESTRQMIGDEAFYNIQKILVLSENQDYTALESY
ISELTNDEMVIISRYFSLLPLLINISEDVDLAYEINLQNNTNVSYLGKLASTIEEVSKKE
DAQSILENVNVVPVLTAHPTQVQRKTVLELTNKIHDLLRKYRDVKTGIANRDKWLQELRR
YVDIIMQTDIIREKKLKVKNEITNVMEYYNASLIDAVTKLTSEYKALAQAKGLDLQNPKP
ITMGMWIGGDRDGNPFVTAETLRLSAKIQSEVIITYYIEKLSHLYRSFSLSNTLTKVSAE
VEQLAKLSQDQSIYRENEPYRKAFHYIQSRMVETLNALAPNSNKKTRKHRSSGTCLPKSG
RI
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtcaacaaactagaaagccgtaataataccgaaattatagcagaagaagtagct
attttaaaagaaatgttggaagaaagcactcgtcaaatgattggcgatgaggccttttat
aatattcaaaaaatccttgttttatccgaaaaccaagattacacagccttagaatcttat
atttctgagcttactaatgatgagatggttatcatttcacgctatttttcattgttacct
cttttgatcaatatttcagaggatgtggatttagcttatgaaattaaccttcaaaataat
actaatgtctcttatttaggaaagttggcttcaaccattgaagaagtttctaaaaaagaa
gatgctcagtccattttggaaaatgttaatgtggtacctgtgcttacagctcatccaact
caggttcagcgtaaaactgttcttgaattaaccaataaaattcacgatttgttacgcaag
tatcgtgatgttaaaacaggaattgcaaacagggataaatggttacaagaattgcgtcga
tatgttgatattatcatgcagactgacatcatccgtgaaaaaaaactcaaagtcaaaaat
gaaattacaaatgtcatggagtattacaatgcttcgttaattgacgccgttaccaaatta
acaagtgaatacaaagccttagcccaagcaaaagggcttgatttgcaaaatcctaaaccc
attacaatgggcatgtggataggtggtgaccgtgatggaaatccttttgtcactgctgaa
accttgagactttcggctaagattcaaagtgaggtgattatcacttactatattgaaaag
ttatcccatctctatagaagtttctcactgtcaaacactttaacaaaggttagtgcagaa
gttgaacaattagctaagttatcacaggaccaatctatctaccgtgaaaatgaaccttat
aggaaggcttttcattacattcaatcacgtatggtggaaaccctaaatgccctagcacct
aatagcaataaaaaaacgagaaaacacaggtcttcaggtacctgcctaccaaaaagcgga
agaatttaa

DBGET integrated database retrieval system