KEGG   Streptococcus iniae: K710_1468Help
Entry
K710_1468         CDS       T02686                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sik  Streptococcus iniae
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sik03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1420420..1421259)
Genome map
AA seq 279 aa AA seqDB search
MPELPEVETVRRGLSDLVTGKKIASLQVTVPKMVKTDFDLFQLLLPGQTIYSVDRRGKYL
LFYFENDVLISHLRMEGKYLLFEGAVPENKHFHFFFTFTDGSTLVYQDVRKFGTFDFLPQ
NALENFFLSRKIGPEPTETDFKLKDFEAALLLSQKPIKPNLLEQKLVAGLGNIYVDEVLF
AAKVHPARKSCHLKKAEMKRIHDETIRILKFAIEKGGSTIRTYQNTLGMDGSMQDYLQVY
GQTDKPCPRCGTAIEKIQFAGRGTHFCPKCQKKEVVSLA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattaccagaggttgaaacggtccgtcgtggtttatcagatttggttacagga
aaaaagattgcatcacttcaagtgacagttcctaaaatggttaaaacagattttgacctt
tttcaattattattgccgggtcaaaccatctactctgtagatcgtcgtggcaaataccta
ctgttttattttgaaaatgacgtgctcatttcacatttacgaatggaaggaaaatatttg
ctttttgagggggcagtacctgaaaataagcattttcattttttctttacatttacggat
gggtctactttggtttatcaggatgttcgtaagtttgggacctttgattttctgccccaa
aatgctttagaaaatttctttttatctcggaaaatcggtccagaaccaacagaaacagac
tttaaattgaaagactttgaagcagctctgctattatctcaaaaacccatcaagccaaat
ttgttagagcaaaaacttgttgccggtctgggaaatatttatgtggatgaagttcttttt
gcggccaaggttcatccagcacgtaaaagttgtcatttgaaaaaagctgaaatgaaaaga
attcatgatgaaaccatcaggattttgaagtttgcgattgaaaaaggtggatcgaccatt
agaacataccagaatactctgggcatggatggctcaatgcaggactatttacaggtttac
ggtcagacagataagccttgtccacggtgtggcactgccattgaaaagatacaatttgct
ggaagggggacccatttttgtccaaagtgtcagaaaaaagaagtcgtgtcattggcttaa

DBGET integrated database retrieval system