KEGG   Streptococcus iniae: K710_1860Help
Entry
K710_1860         CDS       T02686                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sik  Streptococcus iniae
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sik00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    K710_1860
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    K710_1860
Enzymes [BR:sik01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     K710_1860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1805771..1807753)
Genome map
AA seq 660 aa AA seqDB search
MKWLNSFLVATLLLQSVSLGVVGVQADEKTAFSEIEVHVTQKGVYNDQKMDSLTFRPLTE
ALSGQTVRIYPDNTRQEFLGLGGAMTESSAYNIAGLTEEQQNAIYQAYFSEEGAHYSLLR
SSIGSADFSIKSYSYDDTESPDPNLEHFSIADDHDFVIPAIKRAQSYRSDLKLFAAPWAP
PAWMKKSGVRRGQTGTAAVNLIDNSLKPEYYDSYAHYFVKYLQAYAKEGIPVYSISLQNE
AQNNPKWEATTWNSAQAADFIGNYLGPALEKNNLDPKVLVWDWDKGNDSMHGEGFIKYNL
SLLQNDKARKYIDGIAFHWYAGDIWHEIAGKPMWSRDFYSLDAVKAKYPDIDLYATEACQ
EKGAWFNSFDPADRYIYDILNDFEHGTKSWIDWNLVLDHSGGPTQGVSNPVHAPILLDEH
KNIVFQPSYYILKRLSQEIQPGSVSIESYSDTAIEKTAVKQADGSRVVFLGNVSDLAKTV
NLVEGNAFTQVRLEPHSLTSLKYKPLDTTPQEPSDPTRPVFEKTSKMKPVAATASSYEQN
PIKNYEASSAIDESLDTRWASDWKDEESILFDLGESQYVNRLEFLFENNYNAKYSIWVSE
DGQDFRQVSSISKNQFQTPNVNIDFPATKARYIKLQGEERANRYGYSIYNVLVTTLIERK
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggttaaacagttttttagttgctaccttgctcttacagtctgtatctctgggt
gttgttggggttcaggcagatgagaagactgcttttagtgagattgaagtgcatgtcacc
caaaaaggtgtttataatgatcaaaaaatggattccttaacctttcgacctcttacggaa
gctttatctggtcagactgttcgcatttatccagacaatacgcgtcaggaatttctgggt
ctgggtggggcaatgacggaatcttctgcttataatattgcaggcttaactgaagagcag
caaaatgctatttatcaggcctacttttctgaggagggagcccattattccttgctgagg
tcctcaattggttcggctgatttttctattaaatcttacagttatgatgatacagagtcg
ccagatcctaatttagaacactttagcattgctgatgatcatgattttgttattccggcc
atcaagcgtgcacagtcttatcgttctgatttgaaattgtttgcagcaccttgggcacct
cctgcttggatgaaaaaaagcggcgtcagacgtggtcaaactggaacagctgctgttaat
ttaattgataattcgctaaaaccagaatactatgacagttacgctcattattttgtcaag
tatttacaagcttatgctaaagaagggattccagtttactctatttcacttcaaaatgaa
gctcaaaataatccgaaatgggaagcaacgacctggaactctgcacaagctgccgatttt
attggcaattatttaggccctgccttagaaaaaaataatttggatcctaaagtgttggtt
tgggattgggataagggaaatgatagcatgcatggtgaaggctttattaagtataacctt
tctctcttgcaaaatgacaaagcccgaaaatatattgatggtattgcttttcactggtat
gctggagatatttggcatgaaattgctggaaaaccaatgtggtcacgagatttctacagt
ttggatgcggttaaagcaaaatatcccgatattgacctttatgcaacagaagcttgtcaa
gaaaaaggagcatggtttaacagttttgaccctgctgaccgttatatttatgatattttg
aatgactttgagcatggaacaaaatcctggattgattggaatcttgttttagaccatagt
ggtggaccaactcaaggagtgtctaatccagtgcatgctccaattcttttagatgaacat
aagaatattgtttttcaaccttcttactatatcttgaaacgcttgagtcaagagatacag
ccgggttcagttagcatcgagtcttactcagatacagctattgaaaaaacagctgttaaa
caggcggatggtagtcgtgtcgtctttttaggaaatgtttcagatcttgctaaaaccgtt
aatcttgttgagggaaatgcttttacacaagttaggttagagccacattctctaacaagt
ttgaaatacaaacccttggatacaactcctcaagagccgtcagatccgactaggccagta
tttgaaaaaaccagcaagatgaaaccagttgcagcaacagctagcagttatgaacaaaat
ccaatcaaaaattatgaagcaagctcagctattgatgagagtttagatacccgttgggca
agtgattggaaagatgaggaatccattttatttgacttgggagaaagtcagtatgttaac
agattagaatttctttttgaaaataattataatgctaaatattctatttgggtctctgaa
gatggacaagattttagacaagtgtcatcaatatccaaaaaccaatttcaaacaccaaat
gtcaatattgactttccagcaactaaagctcgctatataaaattgcaaggggaagaacgg
gctaatcgttatggttattccatttataatgtcttagtaacgacactaatagagagaaaa
tga

DBGET integrated database retrieval system