KEGG   Ruegeria pomeroyi: SPO0093Help
Entry
SPO0093           CDS       T00215                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sil  Ruegeria pomeroyi
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SPO0093 (pncA)
Enzymes [BR:sil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SPO0093 (pncA)
    3.5.1.-  
     SPO0093 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
92595..93185
Genome map
AA seq 196 aa AA seqDB search
MHGLIVIDVQNDFCPGGALAVPEGDAVVAPINAMMKDFDAVVLTQDWHPAGHSSFASSHP
GQAPFEMIEMAYGPQVLWPDHCVQGSPGAAFHPALRTDADLILRKGFRAAIDSYSGFFEN
DRSTPTGLEGYLRSRGITRLTLAGLATDFCVQYSALDAARLGFAVEVRMQACRAIDLDGS
LAAAIAAMKAGGIALT
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcatggcctgatcgtgatcgacgtccagaacgacttctgccccggcggtgccctggcg
gtgcccgaaggcgacgcggtggtggcgccgatcaacgccatgatgaaggatttcgacgcg
gtggtcctgacgcaggattggcacccggcggggcattcctctttcgcttcgtcccatccg
ggccaagcaccgttcgagatgatcgagatggcctatgggccgcaggtgttgtggcccgac
cattgcgtgcagggcagccccggcgctgcgtttcacccggcgctgcggaccgatgccgat
ttgatcctgcgcaaggggttccgcgccgcgatcgacagctattcgggcttcttcgaaaac
gaccgcagcacgcccaccggcctcgagggctatttgcgcagccggggcatcacccgactg
acgctggccggactcgccaccgatttctgcgtgcagtattcggcgctggatgcggcgcgg
ctgggctttgccgtcgaggtgcggatgcaggcctgtcgcgccatcgatctggacgggtcg
ctggcggcggcgattgccgcgatgaaggcgggcgggattgctctgacctga

DBGET integrated database retrieval system