KEGG   Ruegeria pomeroyi: SPO0093Help
Entry
SPO0093           CDS       T00215                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sil  Ruegeria pomeroyi
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:sil00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
92595..93185
Genome map
AA seq 196 aa AA seqDB search
MHGLIVIDVQNDFCPGGALAVPEGDAVVAPINAMMKDFDAVVLTQDWHPAGHSSFASSHP
GQAPFEMIEMAYGPQVLWPDHCVQGSPGAAFHPALRTDADLILRKGFRAAIDSYSGFFEN
DRSTPTGLEGYLRSRGITRLTLAGLATDFCVQYSALDAARLGFAVEVRMQACRAIDLDGS
LAAAIAAMKAGGIALT
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcatggcctgatcgtgatcgacgtccagaacgacttctgccccggcggtgccctggcg
gtgcccgaaggcgacgcggtggtggcgccgatcaacgccatgatgaaggatttcgacgcg
gtggtcctgacgcaggattggcacccggcggggcattcctctttcgcttcgtcccatccg
ggccaagcaccgttcgagatgatcgagatggcctatgggccgcaggtgttgtggcccgac
cattgcgtgcagggcagccccggcgctgcgtttcacccggcgctgcggaccgatgccgat
ttgatcctgcgcaaggggttccgcgccgcgatcgacagctattcgggcttcttcgaaaac
gaccgcagcacgcccaccggcctcgagggctatttgcgcagccggggcatcacccgactg
acgctggccggactcgccaccgatttctgcgtgcagtattcggcgctggatgcggcgcgg
ctgggctttgccgtcgaggtgcggatgcaggcctgtcgcgccatcgatctggacgggtcg
ctggcggcggcgattgccgcgatgaaggcgggcgggattgctctgacctga

DBGET integrated database retrieval system