KEGG   Ruegeria pomeroyi: SPO0104Help
Entry
SPO0104           CDS       T00215                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sil  Ruegeria pomeroyi
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sil00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
106644..108122
Genome map
AA seq 492 aa AA seqDB search
MTFILAIDQGTTSSRAILFDGEMRRVATAQREFTQHFPEAGWVEHDAEEIWQTTVEVCRE
VIAGQGIGPEQIAGIGITNQRETTVVWDKAGGAPVHRAIVWQDRRTAAICERLRHAGCED
DFTAQTGLLLDPYFSGTKVKWILDTVPGARDRAAAGELLFGTIDSFLIWRLTGGRVHASD
ATNAARTLMFDIHQGEWSKDICELLDVPMSMLPEVRDCAADFGTTDLFGGQVPILGVAGD
QQAATIGQACFQPGMMKSTYGTGCFALLNTGTQPVASQNRLLTTIAYQLDGQRTYALEGS
IFIAGAAVQWLRDGLGIIENAAQSGALAARADPAQNVILVPAFTGLGAPYWKPDCRGAMF
GLTRNSGPAEFCKAALESVAYQTRDLWEAMQGDWGADADVILRVDGGMSASDWAMQGLAD
RLGAPVDRPVMQETTALGAAWLAGMRAGVYPDQAGFAATWALDARFTPKMVEGDREAAYR
RWKAAVAAAMMV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgacctttattctggcgatcgaccagggcaccacttcgagccgggcgatcctgttcgat
ggcgagatgcggcgggtggcgaccgcgcagcgtgaattcacccagcatttccccgaagcg
ggctgggtggaacacgacgccgaagagatctggcaaacgacggtcgaggtctgccgcgag
gtgatcgccgggcaggggatcgggcccgaacagatcgccgggatcggcatcaccaaccag
cgggaaaccaccgtggtctgggacaaggccggcggtgcgcccgtgcatcgcgccatcgtc
tggcaggaccggcgcaccgctgcgatttgtgagcggctgcgccatgcggggtgcgaggat
gactttaccgcccagaccggtctgctgctggacccgtatttctcgggcaccaaggtgaaa
tggatcctcgacaccgtgccgggcgcgcgggatcgcgcggcggcgggcgagctgctgttc
ggcaccatcgattcgtttttgatctggcggctgaccggtggccgggttcatgcgagtgat
gcgaccaacgccgcgcgcacgctgatgttcgatatccatcagggggaatggagcaaggac
atctgcgagcttcttgacgtgccgatgtcgatgctgcccgaggtgcgcgactgcgctgcc
gatttcggcacgacggatctgtttggcgggcaggtgccgatcctgggcgttgccggcgac
cagcaggcggccaccatcgggcaggcctgtttccagcccggcatgatgaaatccacctat
ggcaccggttgttttgcgctgctcaataccgggacacagccggtcgcctcgcagaaccgg
ctgctgacgaccatcgcctatcagctggacggccagcggacctatgcgctggaaggctcg
atcttcattgccggggcggcggtgcagtggctgcgcgacgggctgggtatcatcgagaac
gcggcgcaaagcggcgcgttggcggctcgcgccgatccggcccagaatgtcatcctggtg
cccgcctttaccggtctgggcgccccctattggaagcccgattgccggggcgcaatgttc
gggctgacgcgcaactccggtccggccgagttctgcaaggcggcgctggaaagcgtggcc
tatcagacccgcgatctgtgggaggcgatgcagggcgattggggtgcggatgcggatgtg
atcctgcgtgtcgatggcggtatgagcgcgtccgactgggcgatgcagggcctggccgat
cgtctgggcgcgccggtggaccgcccggtgatgcaggagaccacggcgctgggcgcggcc
tggctggccgggatgcgggcaggggtttaccccgatcaggcaggctttgccgcgacctgg
gcgctagatgcccggttcacccccaagatggtcgagggcgaccgcgaagccgcctatcgc
cgctggaaagcggcagtggcggcggcgatgatggtctag

DBGET integrated database retrieval system