KEGG   Ruegeria pomeroyi: SPO0142Help
Entry
SPO0142           CDS       T00215                                 

Gene name
bktB
Definition
(GenBank) beta-ketothiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00071  Fatty acid degradation
sil00072  Synthesis and degradation of ketone bodies
sil00280  Valine, leucine and isoleucine degradation
sil00310  Lysine degradation
sil00362  Benzoate degradation
sil00380  Tryptophan metabolism
sil00620  Pyruvate metabolism
sil00630  Glyoxylate and dicarboxylate metabolism
sil00640  Propanoate metabolism
sil00650  Butanoate metabolism
sil00900  Terpenoid backbone biosynthesis
sil01100  Metabolic pathways
sil01110  Biosynthesis of secondary metabolites
sil01120  Microbial metabolism in diverse environments
sil01130  Biosynthesis of antibiotics
sil01200  Carbon metabolism
sil01212  Fatty acid metabolism
sil02020  Two-component system
Module
sil_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPO0142 (bktB)
   00630 Glyoxylate and dicarboxylate metabolism
    SPO0142 (bktB)
   00640 Propanoate metabolism
    SPO0142 (bktB)
   00650 Butanoate metabolism
    SPO0142 (bktB)
  Lipid metabolism
   00071 Fatty acid degradation
    SPO0142 (bktB)
   00072 Synthesis and degradation of ketone bodies
    SPO0142 (bktB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPO0142 (bktB)
   00310 Lysine degradation
    SPO0142 (bktB)
   00380 Tryptophan metabolism
    SPO0142 (bktB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPO0142 (bktB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPO0142 (bktB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SPO0142 (bktB)
Enzymes [BR:sil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPO0142 (bktB)
Exosome [BR:sil04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPO0142 (bktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAV93470
UniProt: Q5LWU3
Position
156963..158138
Genome map
AA seq 391 aa AA seqDB search
MTDIVILDGARTAIGTFGGALASTAPIDLATVVTEAALERSGVEGGQIGHVVFGHVINTE
PRDMYLSRVAAMQAGIPNGTPAMNVNRLCGSGAQAIVSAVQSLMLGDAEFAVAGGAESMS
RSPFIMTQARWGAKMGDVKSLDMMLGALNCPFGTGHMGVTAENVADEHQISREQMDQFAM
TSQERAAAAIAAGHFDGQITPVQVKVKRDMVDFKVDEHPKATSVEVLAGLKPVFKKDGRV
TAGNASGINDGAAAMVLATADAAEKAGLKPKARILGYAHAGVRPEVMGIGPVPAVQNLLA
RTGLSIGDFDVIESNEAFAAQALAVNKELGLDAAKVNPNGGAIALGHPVGATGAIITLKT
LYELERTGGSKGLITMCIGGGQGIAIAIELL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcgtgattctggacggtgcccgcaccgccataggcacttttggcggggcg
ctggcctcgaccgcgcccatcgacctggccaccgtggtgaccgaggcggcgctggaacgt
tcgggcgtcgaaggcggccagatcggccatgtggtgttcggccatgtgatcaataccgaa
ccccgcgacatgtatctgagccgcgttgccgccatgcaggcgggcatcccgaacggcacc
cccgcgatgaacgtgaaccgcctgtgcggctcgggtgcgcaggccatcgtctcggcggtg
caatcgctgatgctgggggatgccgaattcgcggtggccggtggtgccgaaagcatgtcg
cgcagcccgttcatcatgacccaggcccgctggggcgccaagatgggcgatgtcaaatcg
ctcgacatgatgctgggcgcgttgaattgcccgtttggcaccgggcacatgggtgtgacc
gccgaaaatgtcgccgacgagcaccagatcagccgtgaacagatggaccagttcgccatg
acctcgcaggaacgcgcggcggcggccatcgcggcggggcacttcgacggccagatcacg
cccgtacaggtcaaggtcaagcgcgacatggtcgatttcaaggtcgacgagcaccccaag
gcaacctcggtcgaggtactggccgggctgaagccggtgttcaagaaggatggccgggtg
acagcaggtaacgccagcggcatcaacgatggtgcggcggcgatggtgctggccacggcg
gatgcggccgaaaaggccgggctgaagcccaaggcgcgcattctgggttatgcccatgcc
ggcgtgcgccccgaggtgatggggatcggcccggttcccgcggtgcagaatctgttggcg
cgtaccgggctgagcatcggcgatttcgacgtgatcgaaagcaacgaggcctttgccgcg
caggcactggcggtgaacaaggagctgggcctggatgcggccaaggtgaatcccaatggc
ggcgcgattgcccttggccacccggtcggcgcaaccggtgcgatcatcacgctgaaaacg
ctttatgaactggagcgcaccggcggatccaagggtctgatcaccatgtgcatcggtggc
ggacagggcatcgccatcgccatcgagctgctctga

DBGET integrated database retrieval system