KEGG   Ruegeria pomeroyi: SPO0142Help
Entry
SPO0142           CDS       T00215                                 

Gene name
bktB
Definition
(GenBank) beta-ketothiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sil  Ruegeria pomeroyi
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPO0142 (bktB)
   00630 Glyoxylate and dicarboxylate metabolism
    SPO0142 (bktB)
   00640 Propanoate metabolism
    SPO0142 (bktB)
   00650 Butanoate metabolism
    SPO0142 (bktB)
  Lipid metabolism
   00071 Fatty acid degradation
    SPO0142 (bktB)
   00072 Synthesis and degradation of ketone bodies
    SPO0142 (bktB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPO0142 (bktB)
   00310 Lysine degradation
    SPO0142 (bktB)
   00380 Tryptophan metabolism
    SPO0142 (bktB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPO0142 (bktB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPO0142 (bktB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SPO0142 (bktB)
Enzymes [BR:sil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPO0142 (bktB)
Exosome [BR:sil04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPO0142 (bktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
156963..158138
Genome map
AA seq 391 aa AA seqDB search
MTDIVILDGARTAIGTFGGALASTAPIDLATVVTEAALERSGVEGGQIGHVVFGHVINTE
PRDMYLSRVAAMQAGIPNGTPAMNVNRLCGSGAQAIVSAVQSLMLGDAEFAVAGGAESMS
RSPFIMTQARWGAKMGDVKSLDMMLGALNCPFGTGHMGVTAENVADEHQISREQMDQFAM
TSQERAAAAIAAGHFDGQITPVQVKVKRDMVDFKVDEHPKATSVEVLAGLKPVFKKDGRV
TAGNASGINDGAAAMVLATADAAEKAGLKPKARILGYAHAGVRPEVMGIGPVPAVQNLLA
RTGLSIGDFDVIESNEAFAAQALAVNKELGLDAAKVNPNGGAIALGHPVGATGAIITLKT
LYELERTGGSKGLITMCIGGGQGIAIAIELL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcgtgattctggacggtgcccgcaccgccataggcacttttggcggggcg
ctggcctcgaccgcgcccatcgacctggccaccgtggtgaccgaggcggcgctggaacgt
tcgggcgtcgaaggcggccagatcggccatgtggtgttcggccatgtgatcaataccgaa
ccccgcgacatgtatctgagccgcgttgccgccatgcaggcgggcatcccgaacggcacc
cccgcgatgaacgtgaaccgcctgtgcggctcgggtgcgcaggccatcgtctcggcggtg
caatcgctgatgctgggggatgccgaattcgcggtggccggtggtgccgaaagcatgtcg
cgcagcccgttcatcatgacccaggcccgctggggcgccaagatgggcgatgtcaaatcg
ctcgacatgatgctgggcgcgttgaattgcccgtttggcaccgggcacatgggtgtgacc
gccgaaaatgtcgccgacgagcaccagatcagccgtgaacagatggaccagttcgccatg
acctcgcaggaacgcgcggcggcggccatcgcggcggggcacttcgacggccagatcacg
cccgtacaggtcaaggtcaagcgcgacatggtcgatttcaaggtcgacgagcaccccaag
gcaacctcggtcgaggtactggccgggctgaagccggtgttcaagaaggatggccgggtg
acagcaggtaacgccagcggcatcaacgatggtgcggcggcgatggtgctggccacggcg
gatgcggccgaaaaggccgggctgaagcccaaggcgcgcattctgggttatgcccatgcc
ggcgtgcgccccgaggtgatggggatcggcccggttcccgcggtgcagaatctgttggcg
cgtaccgggctgagcatcggcgatttcgacgtgatcgaaagcaacgaggcctttgccgcg
caggcactggcggtgaacaaggagctgggcctggatgcggccaaggtgaatcccaatggc
ggcgcgattgcccttggccacccggtcggcgcaaccggtgcgatcatcacgctgaaaacg
ctttatgaactggagcgcaccggcggatccaagggtctgatcaccatgtgcatcggtggc
ggacagggcatcgccatcgccatcgagctgctctga

DBGET integrated database retrieval system