KEGG   Ruegeria pomeroyi: SPO0146Help
Entry
SPO0146           CDS       T00215                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sil  Ruegeria pomeroyi
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sil03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
161604..162455
Genome map
AA seq 283 aa AA seqDB search
MPELPEVETVRRGLAPAMEGAVIARAEVNRPDLRWPFPDRMAERLTGQRVERLRRRSKYI
LADLSGGETLLIHLGMSGRMTVSGDPLGQFVHDHPAAQKHDHVVFHMDNGARITFNDPRR
FGAMDLMATATADEHKLLMVLGPEPLGNDFHEDYLVAALKGRNTPVKSALLDQGIVAGLG
NIYVCEALFRAGVSPRRKAGQIAAARVSALVPIIRQVLSEAIEAGGSSLKDFRQADGELG
YFQHSFDVYGREGEPCRRAGCDGTVQRITQSGRSSFYCAQCQR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattgcccgaggtcgagaccgtgcggcgcggattggcccccgcgatggagggg
gcggtgatcgcgcgggccgaagtcaatcggcccgacctgcgctggcctttccccgatcgc
atggccgagcggctgacaggccagcgggtcgaacggctgcggcggcggtcgaaatacatc
ctggccgatctgtcggggggcgagacgctgttgatccatctgggcatgtcggggcggatg
accgtgtcgggtgacccgctggggcagttcgtgcatgaccacccggcggcgcagaaacat
gaccatgtggtgtttcacatggacaacggcgcccgcatcaccttcaacgacccgcgccgg
ttcggtgcgatggacctgatggccaccgcaaccgcggatgaacacaagctgttgatggtg
ctgggccccgagccgctgggcaacgattttcacgaggattacctggttgccgccctcaag
ggccgcaacacgccggtgaaatctgcgctgctggatcagggaatcgtggcggggctgggc
aatatctatgtctgcgaggcgctgttccgggccggggtgtcgccgcgtcgcaaggcggga
cagatcgccgccgcgcgggtctctgcgctggttccgatcattcgccaggtcctgtccgag
gcgatcgaggcgggtggatcctcgctcaaggatttccgccaagccgatggagaacttggg
tattttcagcacagcttcgatgtctacgggcgcgagggggaaccctgccgccgcgcgggc
tgtgacggcacggtgcagagaatcacccagtccggacgctcatccttctattgcgcgcaa
tgccaaagataa

DBGET integrated database retrieval system