KEGG   Ruegeria pomeroyi: SPO0347Help
Entry
SPO0347           CDS       T00215                                 

Definition
(GenBank) succinyl-CoA synthase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00020  Citrate cycle (TCA cycle)
sil00640  Propanoate metabolism
sil00660  C5-Branched dibasic acid metabolism
sil01100  Metabolic pathways
sil01110  Biosynthesis of secondary metabolites
sil01120  Microbial metabolism in diverse environments
sil01130  Biosynthesis of antibiotics
sil01200  Carbon metabolism
Module
sil_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sil_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPO0347
   00640 Propanoate metabolism
    SPO0347
   00660 C5-Branched dibasic acid metabolism
    SPO0347
Enzymes [BR:sil01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SPO0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AAV93665
UniProt: Q5LXC4
Position
complement(360913..362106)
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQAKALLRSYGAPVSDGRVVLRAEDAKTAAGELDGPLWVVKAQIHAGGRGKGKFK
EADAGEKGGVRLTKSVEEAAEEAKKMLGRTLVTHQTGPVGKQVNRIYIEAGSGIERELYL
ALLVDRQTSRISFVCSTEGGMDIEEVAASTPEKILSFSVDPVTGYQPYHGRRIAFSLGLE
GPQVKQCVALMGLLYKAFVEKDMEMLEINPLIVAEGGSLKVLDAKVGFDGNAIYRHSDIA
ELRDTTEEDPKELEASKYDLNYIALDGEIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGATKEKVTEAFKIITSDPNVKGILVNIFGGIMRCDVIAEGVVAAVKEVGLQVPLVVRLE
GTNVEKGKEIINTSGLNVIAADNLSDGAEKIVKAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccatgaatatcaggcaaaggcccttctgcgcagctatggcgcgccggtttcg
gacggccgcgtggtgctgcgtgcagaagacgccaaaaccgccgccggcgaactggacggc
ccgctatgggtcgtcaaggcgcagatccacgcgggcggccgtggcaagggcaagttcaag
gaggccgatgccggtgaaaagggcggcgtccgtctgaccaaatcggtcgaagaggccgcc
gaagaagccaagaagatgctgggccgtaccctggtcacccatcagaccggcccggtgggc
aagcaggtcaaccgcatctatatcgaggccggctccggcatcgaacgggaactgtacctg
gccctgctggtcgaccgtcagaccagccgcatctcgtttgtctgctcgaccgaaggcggc
atggacatcgaagaggtcgccgccagcacgcccgagaagatcctgtccttcagcgtcgat
ccggtgaccggctaccagccctatcatggccgccgcatcgcgttttcgctcggcctcgaa
gggccgcaggtgaaacaatgcgtcgcgctgatgggtctcctctacaaggccttcgtcgag
aaggacatggagatgctggagatcaacccgctgatcgtggccgagggcggcagcctcaag
gtgctggacgccaaagtcggctttgacggcaacgcgatctatcgccactcggacatcgcc
gaactgcgcgacaccaccgaagaggatcccaaggaactggaagcctccaaatacgacctg
aactacatcgcgctggatggcgagatcggttgcatggtgaacggcgccggtctggcgatg
gccaccatggacatcatcaagctctatggcgccgagcctgccaacttcctcgacgtcggc
ggcggcgctaccaaggagaaggtgaccgaggcgttcaagatcatcacctcggacccgaac
gtcaaaggcatcctggtcaacatcttcggtggcatcatgcgctgtgacgtgatcgccgag
ggcgtggtcgccgcggtcaaggaagtgggccttcaggttccgctggtcgtccgactcgaa
ggcaccaatgtcgaaaagggcaaggagatcatcaacacctccggcctgaacgtcatcgcc
gccgacaacctgtccgacggagccgagaagatcgtgaaagcggtaaagggttaa

DBGET integrated database retrieval system