KEGG   Ruegeria pomeroyi: SPO0359Help
Entry
SPO0359           CDS       T00215                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sil  Ruegeria pomeroyi
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPO0359 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPO0359 (sdhD)
   00650 Butanoate metabolism
    SPO0359 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SPO0359 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
370862..371233
Genome map
AA seq 123 aa AA seqDB search
MRYLTDRKRAVGMGSAKTGTAHFWAMKVSSVALLILIPLFVFTFGPMLGEPHQAVLDYFS
RPFPAIVAALTLVVGFKHFADGAQVLIEDYVHGLMQKILIILVICLSYAAAATGLFAIAR
IAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatctcacagaccgcaaacgcgccgttggcatgggttcggccaagacgggcacc
gctcatttctgggctatgaaggtcagctcggtggccctgctgatcctgatcccgctgttc
gtgttcacctttggcccgatgctgggcgagccgcatcaggcggtgctcgactatttctcg
cgccccttcccggccatcgttgccgccttgacgctggtcgtcggtttcaaacatttcgcc
gacggcgcccaggtgctgatcgaggattacgtgcatggcctgatgcagaaaatcctgatc
atcctggtgatctgcctttcctatgccgctgctgcgaccggccttttcgccatcgcccgc
atcgccctttaa

DBGET integrated database retrieval system