KEGG   Ruegeria pomeroyi: SPO0359Help
Entry
SPO0359           CDS       T00215                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sil  Ruegeria pomeroyi
Pathway
sil00020  Citrate cycle (TCA cycle)
sil00190  Oxidative phosphorylation
sil00650  Butanoate metabolism
sil01100  Metabolic pathways
sil01110  Biosynthesis of secondary metabolites
sil01120  Microbial metabolism in diverse environments
sil01130  Biosynthesis of antibiotics
sil01200  Carbon metabolism
Module
sil_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sil_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sil_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPO0359 (sdhD)
   00650 Butanoate metabolism
    SPO0359 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SPO0359 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF717
Motif
Other DBs
NCBI-ProteinID: AAV93677
UniProt: Q5LXE9
Position
370862..371233
Genome map
AA seq 123 aa AA seqDB search
MRYLTDRKRAVGMGSAKTGTAHFWAMKVSSVALLILIPLFVFTFGPMLGEPHQAVLDYFS
RPFPAIVAALTLVVGFKHFADGAQVLIEDYVHGLMQKILIILVICLSYAAAATGLFAIAR
IAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatctcacagaccgcaaacgcgccgttggcatgggttcggccaagacgggcacc
gctcatttctgggctatgaaggtcagctcggtggccctgctgatcctgatcccgctgttc
gtgttcacctttggcccgatgctgggcgagccgcatcaggcggtgctcgactatttctcg
cgccccttcccggccatcgttgccgccttgacgctggtcgtcggtttcaaacatttcgcc
gacggcgcccaggtgctgatcgaggattacgtgcatggcctgatgcagaaaatcctgatc
atcctggtgatctgcctttcctatgccgctgctgcgaccggccttttcgccatcgcccgc
atcgccctttaa

DBGET integrated database retrieval system