KEGG   Ruegeria pomeroyi: SPO0435Help
Entry
SPO0435           CDS       T00215                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sil  Ruegeria pomeroyi
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SPO0435
Enzymes [BR:sil01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SPO0435
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SPO0435
Lipid biosynthesis proteins [BR:sil01004]
 Fatty acid synthase
  Component type
   SPO0435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
451448..452083
Genome map
AA seq 211 aa AA seqDB search
MRKALIGLLLAGWGMAATAEPVVIAALGDSLTQGYGLVPEQGFVPQLQRWLMAEGAEVTL
INAGVSGDTTAGGAARVAWTLTPEVDAMIVALGGNDLLRGIAPEVARGNLATILTEAQRA
GVAVLLVGMQAPGNYGADYKVAFDAIYPELAAEHSALLAPSFFAGLMAEGDPAAAAGLMQ
GDGIHPNAEGVARIVAALGPFVLDLVQAAEK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaggctttgatcgggcttcttctggcggggtggggcatggctgcaacggccgaa
ccggtggtgatcgccgcgttgggcgacagtttgacccagggttatggcctggtgcccgag
caagggtttgttccgcagctgcaacgctggctgatggccgaaggggccgaggtcacgctg
atcaacgcgggtgtgtcgggcgataccacggcgggtggcgcggcgcgggtggcctggacc
ctgacgcccgaggtggatgcgatgatcgtggcgctgggtggtaacgacctgttgcgcggc
atcgcgcccgaggtggcgcgtggcaacctggccacgatcctgaccgaggcgcagcgggca
ggcgtcgccgtgctgctggtgggcatgcaggcgccgggcaactatggtgccgattacaag
gtggcattcgatgcaatctatcccgagcttgccgccgaacatagcgcgctcctggcgccg
agcttctttgccgggttgatggccgagggcgatccggcagcagcggcgggtctgatgcag
ggcgatggcattcaccctaatgcggagggcgtggcccggatcgtggcggcgctgggcccg
tttgtgctggacctggtgcaggcggcggagaagtga

DBGET integrated database retrieval system