KEGG   Ruegeria pomeroyi: SPO0678Help
Entry
SPO0678           CDS       T00215                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sil  Ruegeria pomeroyi
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sil00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(708546..709505)
Genome map
AA seq 319 aa AA seqDB search
MASHGYDSGRLNLPFVGICTFGKYPYVEDWDSIDADAAILGAPFDFGAQWRSGARMGPRA
IREASTLFSFGHAGAYDFEDDITYLDPAKVRIVDIGDADIVHTDTIKSHANIEFGVRKIL
QAGALPVVLGGDHSINIPCINAFDDQDPIHVVQIDAHLDFVDERHGVRYGHGNPMRRAAE
KAHVTGLTQIGIRNVSSTAKDGYDAARAMGSDIQSVRHVRRMGTAAMLARIPEGVRYYLT
IDIDAFDPSIAPGTGTPSHGGFLYYEVLELIDGLARRGEIAGIDLVEVAPDYDQSGSTSI
LAAQLLMNTLGRVLHHRRR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcatcacacggatatgacagtggacggttgaacctgccctttgtgggcatttgcacc
tttggcaagtacccctatgtcgaggattgggacagtatcgacgcagatgccgcgatcctg
ggtgcgcccttcgatttcggcgcccaatggcgctctggcgcgcgcatggggccacgtgcg
atccgcgaggcctcgaccctgttttccttcggccatgcgggcgcctatgatttcgaggac
gacatcacctatctcgatcccgccaaggtgcggatcgtcgatatcggcgatgccgatatc
gtgcataccgacacgatcaagagccacgccaatatcgaattcggcgtccgcaagatcctg
caggccggggcgttgccggtggtgctagggggtgatcattccatcaacatcccctgtatc
aacgcctttgacgatcaggacccgatccacgtggtgcagatcgacgcgcatctggatttc
gtcgacgaacggcatggcgtgcgctatggccacggcaacccgatgcggcgcgccgcggag
aaggcgcatgtcaccgggttgacccagatcggtatccgcaacgtctcctccaccgcaaag
gacggctatgacgcggcgcgcgccatgggctcggatatccagtcggtgcggcacgtacgg
cggatgggaacggcggcgatgctcgcgcgtatccccgaaggcgtccgctattacctgacc
atcgacatcgacgccttcgacccgtcgatcgcgccgggtaccggcacgcccagtcatggc
gggtttctctattacgaggtgctcgaactgatcgacgggctggcacggcgtggcgagatc
gccgggatcgacctggtcgaggtggcgcccgattacgaccagagcggcagcacctcgatc
ctggcggcgcagcttctgatgaacacgctgggccgggtcctacaccaccgcagacgctag

DBGET integrated database retrieval system