KEGG   Ruegeria pomeroyi: SPO0808Help
Entry
SPO0808           CDS       T00215                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sil  Ruegeria pomeroyi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPO0808 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPO0808 (trpB)
Enzymes [BR:sil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPO0808 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
841824..843074
Genome map
AA seq 416 aa AA seqDB search
MANDLFNSFMSGPDEQGRFGIFGGRFVSETLMPLILSLEEEYEKAKTDPSFWAEMDDLWT
NYVGRPSPLYFAERLTEHLGGAKVYMKRDELNHTGAHKINNVLGQIILARRMGKTRIIAE
TGAGQHGVATATVCAKFGLKCVVYMGAHDVRRQAPNVFRMRLLGAEVIPVTSGRGTLKDA
MNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQSIIGKEAKEQMMKAEGRLPDTIIA
AIGGGSNAMGLFYPFLDDTSVNIIGVEAGGKGVNEKMEHCASLTGGRPGVLHGNRTYLLQ
DDDGQILEGYSISAGLDYPGIGPEHSWLHEVGRAKYVSITDMEALEAFKLCCATEGIIPA
LEPSHALAHVMKLAPELPKDHIIIMNMCGRGDKDIFTVAKFLGFDMSDTEGRDAED
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgaccttttcaattccttcatgtccgggcctgacgaacagggccggttcggg
attttcggaggacgcttcgtcagtgaaacgctgatgccgctgatcctgtcgttggaagag
gaatatgagaaggccaagaccgacccgagtttctgggcggagatggacgatctttggacc
aattatgtgggccgaccctcgccgctctatttcgccgagcggctgaccgagcatctgggc
ggcgccaaggtctatatgaagcgcgacgaattgaaccataccggcgcacacaagatcaac
aacgtgctgggccagatcatcctggcgcgccgcatgggcaagacccggatcatcgccgaa
accggtgctggacagcatggtgtggcgaccgcgacggtctgcgccaagttcggcctgaaa
tgcgtggtctatatgggggcccatgacgtgcgccgccaggcgcccaacgtgttccgcatg
cgtttgttgggggccgaagtgatcccggtcacctcgggccggggcacgctcaaggacgcg
atgaacgacgcgctgcgcgactgggtgaccaatgtgcgcgacacgttctactgcatcggc
acggttgctggcccgcacccctatccggcgatggtgcgcgatttccagtcgatcatcggc
aaggaagccaaggaacagatgatgaaggccgaaggccgtctgcccgacaccatcatcgcc
gccatcggcggtggctctaacgcgatgggcctgttctaccccttcctcgacgatacaagc
gtcaacatcatcggggtcgaggccggcggcaagggcgtcaacgagaagatggaacattgc
gcctcgctgaccggcgggcgtccgggcgttctgcatggtaaccggacctatctgctgcag
gacgacgatggccagatcctcgaaggctattcgatctcggcgggcctcgactatccgggc
atcgggccggaacattcctggctgcatgaggtcgggcgcgccaaatacgtgtcgatcacc
gatatggaggcgctggaagcgttcaagctctgctgtgccaccgaggggatcatcccagcg
ctcgaacccagccacgcgctggcccatgtgatgaaactcgcaccagagctgcccaaggat
cacatcatcatcatgaacatgtgcggccggggcgacaaggacatctttacggtggccaag
ttcctgggatttgacatgtccgataccgaggggcgcgacgccgaggattga

DBGET integrated database retrieval system