KEGG   Ruegeria pomeroyi: SPO0815Help
Entry
SPO0815           CDS       T00215                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sil  Ruegeria pomeroyi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPO0815 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPO0815 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPO0815 (trpA)
Enzymes [BR:sil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPO0815 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(848045..848836)
Genome map
AA seq 263 aa AA seqDB search
MTRIDAKFAELKAQGKKAFVSYVMAGDPDFDTSLELVKGLPGAGVDIIELGLPFTDPMAD
GPTIQLAGQRALDGGMTLQRTLDLATEFRKTDNTTPIVMMGYYNPIYSRGVDRFLADAKA
AGIDGLIVVDLPPEEDSELCLPAQAAGLNFIRLATPTTDDKRLPRVLQNTSGFVYYVSIT
GITGSAEAEATDVGPEVARIKAATDLPVIVGFGINTPEKSRAIASVADGAVVGSAIVGQI
GAGKPVAEVLAFVKTLSDGAHSA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatcgacgccaaattcgccgagttgaaagcccaaggcaagaaagcctttgtc
tcttatgtgatggcgggggacccggatttcgatacctcgctggagctggtcaagggcctg
cccggcgctggggtggatatcatcgaactgggtcttccctttaccgacccgatggcggac
gggcccaccatccagctggccggacagcgcgcgctggatggcggcatgaccttgcagcgg
acgctggatctggcgaccgagttccgcaagacggacaacaccacccccatcgtgatgatg
ggctattacaacccgatctacagccgcggcgtcgaccggttcctggccgatgccaaggcg
gccgggatcgacgggctgatcgtggtcgatctgccgcccgaggaagacagcgagctttgc
ctgcccgcgcaggcggccgggctgaacttcatccggctggcgacaccgacaaccgacgac
aagcgcctgccgcgcgtgctgcagaacacttcgggctttgtctattacgtgtcaatcacc
gggatcaccgggtcggccgaggccgaggcaacggatgtcggcccggaagtggcccggatc
aaggccgcgaccgacctgccggtgatcgtgggcttcggcatcaacacgcccgagaaatcg
cgcgccattgccagcgtagccgacggcgcggttgtcggctcggccatcgtcggccagatc
ggcgcgggcaagccggtggccgaggttctggcctttgtcaaaacgctgtcggacggcgcc
cacagcgcctga

DBGET integrated database retrieval system